BLASTX nr result
ID: Ephedra29_contig00024702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024702 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_001312188.1 hypothetical protein CYtaCp021 [Cycas taitungensi... 54 3e-07 >YP_001312188.1 hypothetical protein CYtaCp021 [Cycas taitungensis] YP_007474664.1 hypothetical_protein (chloroplast) [Cycas revoluta] YP_009308234.1 hypothetical protein (chloroplast) [Cycas panzhihuaensis] BAF64929.1 hypothetical protein (chloroplast) [Cycas taitungensis] AEX99213.1 hypothetical_protein (chloroplast) [Cycas revoluta] AOS53183.1 hypothetical protein (chloroplast) [Cycas panzhihuaensis] Length = 62 Score = 53.5 bits (127), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 113 PLSSSGPGHLSFKEAAGIRLPLGVREKEWFKKSFL 9 PLSSSGPGHLSFKEAAGIRLPLGV + + + ++L Sbjct: 6 PLSSSGPGHLSFKEAAGIRLPLGVLWESFSRNTYL 40