BLASTX nr result
ID: Ephedra29_contig00024679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024679 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007159402.1 hypothetical protein PHAVU_002G235300g [Phaseolus... 53 1e-05 XP_003633097.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 1e-05 >XP_007159402.1 hypothetical protein PHAVU_002G235300g [Phaseolus vulgaris] ESW31396.1 hypothetical protein PHAVU_002G235300g [Phaseolus vulgaris] Length = 679 Score = 52.8 bits (125), Expect = 1e-05 Identities = 22/75 (29%), Positives = 47/75 (62%) Frame = -3 Query: 225 QNYPQKLSQCLALLREANKAKNPKQAEILHGHILKRGGLGVTPQHTNTWNTLLNIHAKCG 46 Q P L +CL L+ + + K+ ++A+I+H H L+ ++P H +T+N +L ++ +CG Sbjct: 311 QLIPVDLPRCLQLMHQCGETKSLEEAKIVHRHALQH----LSPLHVSTYNRILEMYLECG 366 Query: 45 TLREACKLFDEIPHK 1 ++ +A +F+ +P + Sbjct: 367 SVDDALNIFNNMPER 381 >XP_003633097.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Vitis vinifera] XP_010656221.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Vitis vinifera] XP_019078527.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Vitis vinifera] XP_019078528.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Vitis vinifera] Length = 1005 Score = 52.8 bits (125), Expect = 1e-05 Identities = 24/70 (34%), Positives = 42/70 (60%) Frame = -3 Query: 210 KLSQCLALLREANKAKNPKQAEILHGHILKRGGLGVTPQHTNTWNTLLNIHAKCGTLREA 31 +L Q +LR + + + +HG ++K G + P ++ WN+L+N++AKCG+ A Sbjct: 127 RLRQYSGMLRTCASKGDLNEGKAIHGQVIKSG---INPD-SHLWNSLVNVYAKCGSANYA 182 Query: 30 CKLFDEIPHK 1 CK+F EIP + Sbjct: 183 CKVFGEIPER 192