BLASTX nr result
ID: Ephedra29_contig00024532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024532 (494 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS69961.1 hypothetical protein M569_04795, partial [Genlisea au... 55 9e-06 >EPS69961.1 hypothetical protein M569_04795, partial [Genlisea aurea] Length = 350 Score = 54.7 bits (130), Expect = 9e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 399 VGLVSDAFHFSFGCGILSFSLTAMVVSRKNQDDV 298 VGL+SDAFH +FGCG+LSFSL AMVVSR+ D V Sbjct: 97 VGLISDAFHLTFGCGLLSFSLFAMVVSRQKPDHV 130