BLASTX nr result
ID: Ephedra29_contig00024445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024445 (576 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019054228.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-09 KHN07819.1 Pentatricopeptide repeat-containing protein [Glycine ... 67 1e-09 XP_020088420.1 pentatricopeptide repeat-containing protein At4g1... 67 2e-09 XP_020088419.1 pentatricopeptide repeat-containing protein At2g2... 67 2e-09 XP_020088418.1 pentatricopeptide repeat-containing protein At4g1... 67 2e-09 KZM98033.1 hypothetical protein DCAR_014605 [Daucus carota subsp... 66 2e-09 XP_017243979.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 2e-09 OIW19073.1 hypothetical protein TanjilG_10309 [Lupinus angustifo... 66 2e-09 XP_019429659.1 PREDICTED: putative pentatricopeptide repeat-cont... 66 2e-09 XP_018828454.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-09 XP_010466803.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-09 ADE77505.1 unknown [Picea sitchensis] 65 4e-09 XP_002885623.1 pentatricopeptide repeat-containing protein [Arab... 65 4e-09 OAY64705.1 Pentatricopeptide repeat-containing protein [Ananas c... 65 4e-09 KRH71938.1 hypothetical protein GLYMA_02G179600 [Glycine max] 65 5e-09 XP_007159470.1 hypothetical protein PHAVU_002G240000g [Phaseolus... 65 5e-09 EOY32166.1 Pentatricopeptide repeat protein isoform 2 [Theobroma... 65 7e-09 XP_017982030.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 7e-09 OAY75524.1 Pentatricopeptide repeat-containing protein [Ananas c... 65 8e-09 XP_018461190.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 1e-08 >XP_019054228.1 PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Nelumbo nucifera] Length = 694 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 G+ +H ++ NGF + V ALL MYAKCG +EEA QVFD +P+RDFV+WT Sbjct: 428 GKEIHKYVKENGFESDEKVMGALLDMYAKCGTVEEARQVFDRLPVRDFVSWT 479 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAW 5 G+ +H H+++ GF ++ V +L+ MYAKCGL + A Q+F+EMP RD W Sbjct: 125 GKKIHTHVIKTGFEFDVVVASSLVGMYAKCGLFDLAIQLFNEMPNRDVACW 175 >KHN07819.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 443 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAW 5 HG+ VH +++R+GFP +++G AL++MYAKCG ++EA +VFD M RD ++W Sbjct: 288 HGKQVHGYILRHGFPSEVSLGNALVTMYAKCGSLDEALRVFDAMVERDTISW 339 >XP_020088420.1 pentatricopeptide repeat-containing protein At4g14820-like isoform X3 [Ananas comosus] Length = 557 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 GR +H +V NGF LN +G +L+SMYAKCGL+E+A VFDEMP R+ V WT Sbjct: 225 GRRIHALVVVNGFELNHYLGSSLVSMYAKCGLVEDARNVFDEMPDRNVVCWT 276 >XP_020088419.1 pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X2 [Ananas comosus] Length = 585 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 GR +H +V NGF LN +G +L+SMYAKCGL+E+A VFDEMP R+ V WT Sbjct: 225 GRRIHALVVVNGFELNHYLGSSLVSMYAKCGLVEDARNVFDEMPDRNVVCWT 276 >XP_020088418.1 pentatricopeptide repeat-containing protein At4g14820-like isoform X1 [Ananas comosus] Length = 586 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 GR +H +V NGF LN +G +L+SMYAKCGL+E+A VFDEMP R+ V WT Sbjct: 225 GRRIHALVVVNGFELNHYLGSSLVSMYAKCGLVEDARNVFDEMPDRNVVCWT 276 >KZM98033.1 hypothetical protein DCAR_014605 [Daucus carota subsp. sativus] Length = 357 Score = 66.2 bits (160), Expect = 2e-09 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 HG+ VHN+LVR+G ++ VG AL+ MY KCG ++ A +VF+EMP +D +AWT Sbjct: 217 HGKWVHNYLVRSGLECDMVVGTALIDMYGKCGSVKRAFEVFEEMPNKDVLAWT 269 >XP_017243979.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Daucus carota subsp. sativus] Length = 542 Score = 66.2 bits (160), Expect = 2e-09 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 HG+ VHN+LVR+G ++ VG AL+ MY KCG ++ A +VF+EMP +D +AWT Sbjct: 273 HGKWVHNYLVRSGLECDMVVGTALIDMYGKCGSVKRAFEVFEEMPNKDVLAWT 325 >OIW19073.1 hypothetical protein TanjilG_10309 [Lupinus angustifolius] Length = 748 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/73 (39%), Positives = 45/73 (61%) Frame = -3 Query: 223 CEDSSPHXXXXXXXXXXXXXLHGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQ 44 C DSS + G+ +H+H++R+G+ N+ G ALL MYAKCG +++A Q Sbjct: 372 CADSSTYASILRASASLASITLGKLIHSHIIRSGYISNVFSGSALLDMYAKCGSIKDALQ 431 Query: 43 VFDEMPIRDFVAW 5 +F EMP+R+ V+W Sbjct: 432 MFQEMPMRNLVSW 444 >XP_019429659.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Lupinus angustifolius] Length = 822 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/73 (39%), Positives = 45/73 (61%) Frame = -3 Query: 223 CEDSSPHXXXXXXXXXXXXXLHGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQ 44 C DSS + G+ +H+H++R+G+ N+ G ALL MYAKCG +++A Q Sbjct: 446 CADSSTYASILRASASLASITLGKLIHSHIIRSGYISNVFSGSALLDMYAKCGSIKDALQ 505 Query: 43 VFDEMPIRDFVAW 5 +F EMP+R+ V+W Sbjct: 506 MFQEMPMRNLVSW 518 >XP_018828454.1 PREDICTED: pentatricopeptide repeat-containing protein ELI1, chloroplastic-like [Juglans regia] Length = 544 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/53 (49%), Positives = 39/53 (73%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 +G+ VH ++R GF L++ VG A++ MYAKCG M++ACQ F MP ++ V+WT Sbjct: 190 NGKQVHGLVIRYGFDLHIPVGNAIIDMYAKCGCMDDACQFFKNMPAKNVVSWT 242 >XP_010466803.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Camelina sativa] XP_010466804.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Camelina sativa] Length = 641 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 HG+ VH HL+++ F +L + LL+MYAKCG +EEA +VFD+MP RDFV WT Sbjct: 86 HGKIVHAHLIQSIFRHDLVMYNTLLNMYAKCGSLEEARKVFDQMPERDFVTWT 138 >ADE77505.1 unknown [Picea sitchensis] Length = 514 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAW 5 GR H ++V++GF L++ VG AL+ MYAK G ME+ACQVFD+MP R+ V+W Sbjct: 161 GRQFHAYVVQSGFALDIVVGSALVDMYAKSGSMEDACQVFDKMPQRNEVSW 211 >XP_002885623.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] EFH61882.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 624 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 GR VH HL+++ F +L + LL+MYAKCG +EEA +VFD+MP RDFV WT Sbjct: 70 GRIVHGHLIQSIFRHDLVMNNTLLNMYAKCGSLEEARKVFDKMPERDFVTWT 121 >OAY64705.1 Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 635 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 GR +H +V NGF LN +G +++SMYAKCGL+E+A VFDEMP R+ V WT Sbjct: 227 GRRIHALVVVNGFDLNHYLGSSVVSMYAKCGLVEDARNVFDEMPDRNVVCWT 278 >KRH71938.1 hypothetical protein GLYMA_02G179600 [Glycine max] Length = 500 Score = 65.1 bits (157), Expect = 5e-09 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAW 5 HG+ VH +++R+GFP +++G AL++MYAKCG +++A +VFD M RD ++W Sbjct: 288 HGKQVHGYILRHGFPSEVSLGNALVTMYAKCGSLDKALRVFDAMVERDTISW 339 >XP_007159470.1 hypothetical protein PHAVU_002G240000g [Phaseolus vulgaris] ESW31464.1 hypothetical protein PHAVU_002G240000g [Phaseolus vulgaris] Length = 618 Score = 65.1 bits (157), Expect = 5e-09 Identities = 26/51 (50%), Positives = 38/51 (74%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAW 5 GR++HN + +N LNL V AL++MYAKCG MEEA +F ++P++D V+W Sbjct: 165 GRNIHNFIKKNNMALNLPVSNALMNMYAKCGTMEEAHLIFSQIPVKDIVSW 215 >EOY32166.1 Pentatricopeptide repeat protein isoform 2 [Theobroma cacao] Length = 511 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 HGR +H ++ RNG L+ +G AL+ MYAKCG +E AC VFDEMP +D A+T Sbjct: 236 HGRWIHAYVDRNGMELDRVLGTALVDMYAKCGCIEMACSVFDEMPYKDVFAFT 288 >XP_017982030.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] XP_017982031.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] XP_007014547.2 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] EOY32165.1 Pentatricopeptide repeat protein isoform 1 [Theobroma cacao] Length = 537 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -3 Query: 160 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 HGR +H ++ RNG L+ +G AL+ MYAKCG +E AC VFDEMP +D A+T Sbjct: 262 HGRWIHAYVDRNGMELDRVLGTALVDMYAKCGCIEMACSVFDEMPYKDVFAFT 314 >OAY75524.1 Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 828 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAW 5 G +H +++ GF NL VG AL+ MY KCG +EEA +VFD MP+RD V+W Sbjct: 187 GEELHGFVIKKGFCSNLYVGNALIDMYGKCGFVEEATKVFDGMPVRDCVSW 237 >XP_018461190.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Raphanus sativus] Length = 645 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -3 Query: 157 GRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFDEMPIRDFVAWT 2 GR VH H+ ++ F + + LL+MYAKCG +EEA +VFDEMP RDFV WT Sbjct: 88 GRIVHGHVAKSLFRCEVVMNNTLLNMYAKCGSLEEARKVFDEMPQRDFVTWT 139