BLASTX nr result
ID: Ephedra29_contig00024431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024431 (881 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG44367.1 hypothetical protein 0_13398_02, partial [Pinus taeda... 63 7e-09 BAS93772.1 Os05g0381700 [Oryza sativa Japonica Group] 55 5e-06 AAN63633.1 pathogen-induced calmodulin-binding protein, partial ... 56 7e-06 XP_006373723.1 hypothetical protein POPTR_0016s04060g [Populus t... 58 8e-06 XP_002322643.2 hypothetical protein POPTR_0016s04060g [Populus t... 58 8e-06 >AFG44367.1 hypothetical protein 0_13398_02, partial [Pinus taeda] AFG44368.1 hypothetical protein 0_13398_02, partial [Pinus taeda] AFG44369.1 hypothetical protein 0_13398_02, partial [Pinus taeda] AFG44370.1 hypothetical protein 0_13398_02, partial [Pinus taeda] AFG44371.1 hypothetical protein 0_13398_02, partial [Pinus taeda] AFG44372.1 hypothetical protein 0_13398_02, partial [Pinus taeda] AFG44373.1 hypothetical protein 0_13398_02, partial [Pinus taeda] Length = 132 Score = 63.2 bits (152), Expect = 7e-09 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = -1 Query: 170 KISWGKRKVHPSMDEMPENEKVSLMHQDANERRAAYEWMIDYALRELVNKLAPFRK 3 +ISW +R D++ E EKV L HQ ERRAA+EWM+DYAL ++V KL+P + Sbjct: 36 RISWRRRNARSFGDQIAEAEKVDLRHQTIEERRAAHEWMLDYALTQVVKKLSPLHE 91 >BAS93772.1 Os05g0381700 [Oryza sativa Japonica Group] Length = 127 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 122 PENEKVSLMHQDANERRAAYEWMIDYALRELVNKLAPFRK 3 PE+EKV L HQ +ER+ A EWMIDYALR VN L P RK Sbjct: 54 PESEKVDLKHQMMDERKNAEEWMIDYALRRAVNNLGPARK 93 >AAN63633.1 pathogen-induced calmodulin-binding protein, partial [Phaseolus vulgaris] Length = 178 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -1 Query: 143 HPSMDEMPENEKVSLMHQDANERRAAYEWMIDYALRELVNKLAPFRK 3 H ++ E EKV+L HQD ER+ EWM+DYALR++V+KL P RK Sbjct: 113 HLPLEADSEAEKVNLRHQDMEERKGTEEWMLDYALRQVVSKLTPARK 159 >XP_006373723.1 hypothetical protein POPTR_0016s04060g [Populus trichocarpa] ERP51520.1 hypothetical protein POPTR_0016s04060g [Populus trichocarpa] Length = 901 Score = 58.2 bits (139), Expect = 8e-06 Identities = 29/58 (50%), Positives = 41/58 (70%) Frame = -1 Query: 176 IKKISWGKRKVHPSMDEMPENEKVSLMHQDANERRAAYEWMIDYALRELVNKLAPFRK 3 +KKI+ + + P +D + E EKV L HQD ++R+ A EWM+DYALR++V KL P RK Sbjct: 821 VKKINQQEPRFLP-LDPLSEAEKVHLRHQDTDDRKNADEWMLDYALRQVVAKLTPARK 877 >XP_002322643.2 hypothetical protein POPTR_0016s04060g [Populus trichocarpa] EEF04404.2 hypothetical protein POPTR_0016s04060g [Populus trichocarpa] Length = 1241 Score = 58.2 bits (139), Expect = 8e-06 Identities = 29/58 (50%), Positives = 41/58 (70%) Frame = -1 Query: 176 IKKISWGKRKVHPSMDEMPENEKVSLMHQDANERRAAYEWMIDYALRELVNKLAPFRK 3 +KKI+ + + P +D + E EKV L HQD ++R+ A EWM+DYALR++V KL P RK Sbjct: 1161 VKKINQQEPRFLP-LDPLSEAEKVHLRHQDTDDRKNADEWMLDYALRQVVAKLTPARK 1217