BLASTX nr result
ID: Ephedra29_contig00024383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024383 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY23477.1 hypothetical protein MANES_18G081800 [Manihot esculenta] 61 1e-08 XP_011002445.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 XP_002307458.2 pentatricopeptide repeat-containing family protei... 60 4e-08 XP_008383014.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 4e-08 XP_017618551.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 6e-08 KCW70655.1 hypothetical protein EUGRSUZ_F03831 [Eucalyptus grandis] 59 8e-08 XP_018731598.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 8e-08 XP_010521305.2 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_010534732.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_012078305.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-07 XP_016739630.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 58 2e-07 XP_012464132.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_006301167.1 hypothetical protein CARUB_v10021564mg, partial [... 58 2e-07 CDY38351.1 BnaA02g18440D [Brassica napus] 57 3e-07 XP_013718331.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_018470170.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 4e-07 XP_013681351.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 4e-07 XP_013618512.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 4e-07 BAT93408.1 hypothetical protein VIGAN_07236500, partial [Vigna a... 54 4e-07 XP_017699929.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 >OAY23477.1 hypothetical protein MANES_18G081800 [Manihot esculenta] Length = 480 Score = 61.2 bits (147), Expect = 1e-08 Identities = 30/70 (42%), Positives = 45/70 (64%) Frame = -1 Query: 236 RPTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFR 57 +PT E +A KKI ++++++ LD +L++ GV VS E + L+ NAGMVAY FF Sbjct: 26 KPTTEVSDATKKICKIMMSSPAVTLDTALNQNGVRVSPEIVEDVLKKFENAGMVAYRFFE 85 Query: 56 WAQKRRVFQH 27 WA K+R + H Sbjct: 86 WADKQRHYSH 95 >XP_011002445.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Populus euphratica] XP_011002446.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Populus euphratica] XP_011002447.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Populus euphratica] XP_011012108.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Populus euphratica] XP_011012109.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Populus euphratica] XP_011012110.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Populus euphratica] Length = 478 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/68 (39%), Positives = 45/68 (66%) Frame = -1 Query: 230 TKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWA 51 + E + K I ++++++++ LD +LD+ GV VSE+ + L+ NAGMVAY FF WA Sbjct: 25 SSETSDTTKTICKIMMSSSVVTLDTALDQSGVRVSEQIVEDVLKKFENAGMVAYRFFEWA 84 Query: 50 QKRRVFQH 27 +K+R + H Sbjct: 85 EKQRHYNH 92 >XP_002307458.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE94454.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 478 Score = 59.7 bits (143), Expect = 4e-08 Identities = 27/68 (39%), Positives = 44/68 (64%) Frame = -1 Query: 230 TKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWA 51 + E + K I ++++++++ LD +LD+ GV VSE+ L+ NAGMVAY FF WA Sbjct: 25 SSETSDTTKTICKIMMSSSVVTLDTALDQSGVRVSEQIVDDVLKKFENAGMVAYRFFEWA 84 Query: 50 QKRRVFQH 27 +K+R + H Sbjct: 85 EKQRHYNH 92 >XP_008383014.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Malus domestica] XP_008383016.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Malus domestica] XP_008383017.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Malus domestica] Length = 481 Score = 59.7 bits (143), Expect = 4e-08 Identities = 26/72 (36%), Positives = 43/72 (59%) Frame = -1 Query: 242 AVRPTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYF 63 + PT++ + K+I +++++ LD +LD+ G+ +S E + L NAGMVAY F Sbjct: 25 STEPTRQFSDPTKRIFKIMMSCPTLALDTALDQTGIRISPEMVEEVLMRFNNAGMVAYRF 84 Query: 62 FRWAQKRRVFQH 27 F WA K+R + H Sbjct: 85 FEWAAKQRNYSH 96 >XP_017618551.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Gossypium arboreum] XP_017618558.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Gossypium arboreum] Length = 480 Score = 59.3 bits (142), Expect = 6e-08 Identities = 27/69 (39%), Positives = 46/69 (66%) Frame = -1 Query: 233 PTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRW 54 PT++ KK+ +++++++ LD +LD+ G+ VS E A+ L+ NAGM+AY FF W Sbjct: 27 PTRDVSVTSKKVCKIMMSSSPVVLDTALDQSGLRVSPEVAEDVLKRFENAGMLAYRFFEW 86 Query: 53 AQKRRVFQH 27 A+K+R + H Sbjct: 87 AEKQRNYMH 95 >KCW70655.1 hypothetical protein EUGRSUZ_F03831 [Eucalyptus grandis] Length = 460 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/67 (38%), Positives = 45/67 (67%) Frame = -1 Query: 227 KEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWAQ 48 +E E+++KI++++++T LD +LD+ G+ VS + + L+ NAGM+AY FF WA Sbjct: 9 REISESLRKISKIMMSTPALALDTALDQSGIRVSPDIVEDVLKRFENAGMLAYRFFEWAG 68 Query: 47 KRRVFQH 27 K+R + H Sbjct: 69 KQRNYSH 75 >XP_018731598.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Eucalyptus grandis] Length = 477 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/67 (38%), Positives = 45/67 (67%) Frame = -1 Query: 227 KEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWAQ 48 +E E+++KI++++++T LD +LD+ G+ VS + + L+ NAGM+AY FF WA Sbjct: 26 REISESLRKISKIMMSTPALALDTALDQSGIRVSPDIVEDVLKRFENAGMLAYRFFEWAG 85 Query: 47 KRRVFQH 27 K+R + H Sbjct: 86 KQRNYSH 92 >XP_010521305.2 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Tarenaya hassleriana] Length = 481 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/69 (36%), Positives = 46/69 (66%) Frame = -1 Query: 233 PTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRW 54 P ++ + K I +V++++ LD +LD++G+ VS E + L+ NAG++AY FF+W Sbjct: 28 PKRDVSDMAKSICKVMMSSPPAVLDTALDQIGLRVSPEVVETVLQRFRNAGLLAYRFFQW 87 Query: 53 AQKRRVFQH 27 A+K+R ++H Sbjct: 88 AEKQRSYEH 96 >XP_010534732.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Tarenaya hassleriana] Length = 481 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/69 (36%), Positives = 46/69 (66%) Frame = -1 Query: 233 PTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRW 54 P ++ + K I +V++++ LD +LD++G+ VS E + L+ NAG++AY FF+W Sbjct: 28 PKRDVSDMAKSICKVMMSSPPAVLDTALDQIGLRVSPEVVETVLQRFRNAGLLAYRFFQW 87 Query: 53 AQKRRVFQH 27 A+K+R ++H Sbjct: 88 AEKQRSYEH 96 >XP_012078305.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Jatropha curcas] Length = 480 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/69 (40%), Positives = 43/69 (62%) Frame = -1 Query: 233 PTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRW 54 P E + KKI +++++T LD +L++ G+ VS E + L+ NAGMVAY FF W Sbjct: 27 PISEISDVTKKIYKLMMSTPAVTLDTALNQNGIRVSPEIVENVLKKFENAGMVAYRFFEW 86 Query: 53 AQKRRVFQH 27 A+K+R + H Sbjct: 87 AEKQRHYTH 95 >XP_016739630.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Gossypium hirsutum] Length = 467 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/69 (37%), Positives = 45/69 (65%) Frame = -1 Query: 233 PTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRW 54 PT++ KK+ +++++++ LD +LD+ G+ VS E A+ L+ NAGM+AY FF W Sbjct: 27 PTRDVSVTSKKVCKIMMSSSPVVLDTALDQSGLRVSPEVAEDVLKRFENAGMLAYRFFEW 86 Query: 53 AQKRRVFQH 27 +K+R + H Sbjct: 87 TEKQRNYMH 95 >XP_012464132.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Gossypium raimondii] XP_012464133.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Gossypium raimondii] KJB80658.1 hypothetical protein B456_013G109300 [Gossypium raimondii] KJB80659.1 hypothetical protein B456_013G109300 [Gossypium raimondii] KJB80660.1 hypothetical protein B456_013G109300 [Gossypium raimondii] KJB80661.1 hypothetical protein B456_013G109300 [Gossypium raimondii] KJB80662.1 hypothetical protein B456_013G109300 [Gossypium raimondii] Length = 480 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/69 (37%), Positives = 45/69 (65%) Frame = -1 Query: 233 PTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRW 54 PT++ KK+ +++++++ LD +LD+ G+ VS E A+ L+ NAGM+AY FF W Sbjct: 27 PTRDVSVTSKKVCKIMMSSSPVVLDTALDQSGLRVSPEVAEDVLKRFENAGMLAYRFFEW 86 Query: 53 AQKRRVFQH 27 +K+R + H Sbjct: 87 TEKQRNYMH 95 >XP_006301167.1 hypothetical protein CARUB_v10021564mg, partial [Capsella rubella] EOA34065.1 hypothetical protein CARUB_v10021564mg, partial [Capsella rubella] Length = 486 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/75 (33%), Positives = 49/75 (65%) Frame = -1 Query: 251 STKAVRPTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVA 72 S+ + P ++ + K I++V++++ LD +LD+ G+ VS+E + L NAG++A Sbjct: 27 SSSSSEPARDVADVAKNISKVMMSSPQLVLDSALDQSGLRVSQEVVEDVLNRFRNAGLLA 86 Query: 71 YYFFRWAQKRRVFQH 27 Y FF+W++K+R ++H Sbjct: 87 YRFFQWSEKQRHYEH 101 >CDY38351.1 BnaA02g18440D [Brassica napus] Length = 345 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/63 (39%), Positives = 45/63 (71%) Frame = -1 Query: 215 EAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWAQKRRV 36 E KKI++V++++ + L+ +LD+ G+ VS E A+ L NAG++AY FF+W++K+R Sbjct: 29 EVTKKISKVMMSSPQQVLESALDQTGLRVSPEVAEDVLNRFRNAGLLAYRFFQWSEKQRH 88 Query: 35 FQH 27 ++H Sbjct: 89 YEH 91 >XP_013718331.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Brassica napus] Length = 474 Score = 57.4 bits (137), Expect = 3e-07 Identities = 32/95 (33%), Positives = 57/95 (60%) Frame = -1 Query: 311 MAMEMEKHDDIRKDIPSSSGSTKAVRPTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVM 132 MA+ + K + + S+SG V E KKI++V++++ + L+ +LD+ G+ Sbjct: 1 MAIRVLKSRFLSAKLYSTSGQVIDVA------EVTKKISKVMMSSPQQVLESALDQTGLR 54 Query: 131 VSEEQAKVALENLGNAGMVAYYFFRWAQKRRVFQH 27 VS E A+ L NAG++AY FF+W++K+R ++H Sbjct: 55 VSPEVAEDILNRFRNAGLLAYRFFQWSEKQRHYEH 89 >XP_018470170.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Raphanus sativus] Length = 476 Score = 57.0 bits (136), Expect = 4e-07 Identities = 30/79 (37%), Positives = 49/79 (62%) Frame = -1 Query: 263 SSSGSTKAVRPTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNA 84 SSSG V E KKI++V+++ + L+ +LD+ G+ VS E A+ L NA Sbjct: 19 SSSGQVTDVA------EVTKKISKVMMSFPQQVLESALDQTGLRVSPEAAEDVLNRFRNA 72 Query: 83 GMVAYYFFRWAQKRRVFQH 27 G++AY FF+W++K+R ++H Sbjct: 73 GLLAYRFFQWSEKQRHYEH 91 >XP_013681351.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Brassica napus] Length = 476 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/63 (39%), Positives = 45/63 (71%) Frame = -1 Query: 215 EAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWAQKRRV 36 E KKI++V++++ + L+ +LD+ G+ VS E A+ L NAG++AY FF+W++K+R Sbjct: 29 EVTKKISKVMMSSPQQVLESALDQTGLRVSPEVAEDILNRFRNAGLLAYRFFQWSEKQRH 88 Query: 35 FQH 27 ++H Sbjct: 89 YEH 91 >XP_013618512.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Brassica oleracea var. oleracea] Length = 476 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/63 (39%), Positives = 45/63 (71%) Frame = -1 Query: 215 EAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWAQKRRV 36 E KKI++V++++ + L+ +LD+ G+ VS E A+ L NAG++AY FF+W++K+R Sbjct: 29 EVTKKISKVMMSSPQQVLESALDQTGLRVSPEVAEDILNRFRNAGLLAYRFFQWSEKQRH 88 Query: 35 FQH 27 ++H Sbjct: 89 YEH 91 >BAT93408.1 hypothetical protein VIGAN_07236500, partial [Vigna angularis var. angularis] Length = 113 Score = 54.3 bits (129), Expect = 4e-07 Identities = 28/75 (37%), Positives = 46/75 (61%) Frame = -1 Query: 227 KEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVALENLGNAGMVAYYFFRWAQ 48 +E EA +++++V++T LD +L++ GV VS + + L+ NAGM A+ FF WA+ Sbjct: 29 QEVGEASERVSKVMMTCPTLALDTALNQTGVKVSPDLVEDVLKRFENAGMSAFRFFEWAE 88 Query: 47 KRRVFQHRDPRVYEL 3 K+R + H R Y L Sbjct: 89 KQRGYSH-SIRAYHL 102 >XP_017699929.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Phoenix dactylifera] Length = 478 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/85 (32%), Positives = 48/85 (56%) Frame = -1 Query: 281 IRKDIPSSSGSTKAVRPTKEDDEAMKKINRVLVTTNIRDLDKSLDELGVMVSEEQAKVAL 102 IR +S + + PTK ++ +++++ L+++LDE G+ +S E A+ + Sbjct: 16 IRMYSSNSKNAPDVIDPTK-------RLCKIMMSCPSVSLERALDETGIRISTELAEAVI 68 Query: 101 ENLGNAGMVAYYFFRWAQKRRVFQH 27 + NAGM+AY FF W +KRR F H Sbjct: 69 KRFENAGMLAYRFFEWTRKRRGFSH 93