BLASTX nr result
ID: Ephedra29_contig00023872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00023872 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEW09080.1 hypothetical protein CL3618Contig1_02, partial [Pinus... 51 8e-06 >AEW09080.1 hypothetical protein CL3618Contig1_02, partial [Pinus lambertiana] Length = 86 Score = 50.8 bits (120), Expect = 8e-06 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = +1 Query: 1 HVKAKGRERVRFSVDVCNDVAVVDKGGKRKLSDGCYEFQFGDLQHS 138 H++A E+V F+++VC D+++VDK G RKL G + GDLQHS Sbjct: 39 HLQAGAMEKVHFTLNVCKDLSIVDKTGTRKLPVGSHLLHIGDLQHS 84