BLASTX nr result
ID: Ephedra29_contig00023453
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00023453 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010916776.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 5e-07 >XP_010916776.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like [Elaeis guineensis] Length = 715 Score = 56.2 bits (134), Expect = 5e-07 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = -3 Query: 219 GRNYSRVIFCNEGFKETIIGNIKQ-GLYKEVLETFSDMISSEEAEKPDQVTLSAVISACS 43 GR + R+ N T++G + Q GLYKE L F +M SE KPD++T+ + +SAC+ Sbjct: 280 GRVFKRMSVKNSVSWNTLVGGLAQNGLYKEALTVFQEMACSEV--KPDEITVVSALSACA 337 Query: 42 KTRDARRGKQLHAH 1 + D ++GK LHA+ Sbjct: 338 QLGDLQQGKLLHAY 351