BLASTX nr result
ID: Ephedra29_contig00023297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00023297 (527 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN15307.1 hypothetical protein AMTR_s00036p00069860 [Amborella ... 65 9e-11 >ERN15307.1 hypothetical protein AMTR_s00036p00069860 [Amborella trichopoda] Length = 96 Score = 65.1 bits (157), Expect = 9e-11 Identities = 33/65 (50%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Frame = -3 Query: 381 DNQEGGVQSE-ELFTLLRELGGLQVRLSSLMDKMGSLPIDLIRDMRLEIVEVTHQLRNIN 205 D+ E ++ + EL LL+EL LQ R++ LM+K+G+LP+++IRDMR E++EVT QLR +N Sbjct: 32 DDDERRIEIDGELGALLQELSHLQSRMAVLMEKIGTLPLEIIRDMREEVLEVTDQLRTLN 91 Query: 204 TSHHR 190 SH R Sbjct: 92 RSHAR 96