BLASTX nr result
ID: Ephedra29_contig00023009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00023009 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011625237.1 PREDICTED: extra-large guanine nucleotide-binding... 66 5e-10 XP_006849425.1 PREDICTED: extra-large guanine nucleotide-binding... 66 5e-10 XP_017228717.1 PREDICTED: extra-large guanine nucleotide-binding... 63 8e-09 XP_010662910.1 PREDICTED: extra-large guanine nucleotide-binding... 63 8e-09 OAY30040.1 hypothetical protein MANES_15G192700 [Manihot esculen... 62 1e-08 XP_015574480.1 PREDICTED: extra-large guanine nucleotide-binding... 62 1e-08 EEF43528.1 GTP-binding protein alpha subunit, gna, putative [Ric... 62 1e-08 XP_012081049.1 PREDICTED: extra-large guanine nucleotide-binding... 62 2e-08 XP_019430455.1 PREDICTED: extra-large guanine nucleotide-binding... 61 3e-08 XP_019430454.1 PREDICTED: extra-large guanine nucleotide-binding... 61 3e-08 OIV89926.1 hypothetical protein TanjilG_02117 [Lupinus angustifo... 61 3e-08 XP_017223011.1 PREDICTED: extra-large guanine nucleotide-binding... 61 4e-08 XP_010276774.1 PREDICTED: extra-large guanine nucleotide-binding... 61 4e-08 XP_010276773.1 PREDICTED: extra-large guanine nucleotide-binding... 61 4e-08 KYP40828.1 Guanine nucleotide-binding protein alpha-2 subunit [C... 60 7e-08 KOM54508.1 hypothetical protein LR48_Vigan10g040000 [Vigna angul... 60 7e-08 XP_017439906.1 PREDICTED: extra-large guanine nucleotide-binding... 60 7e-08 XP_017439905.1 PREDICTED: extra-large guanine nucleotide-binding... 60 7e-08 XP_014515184.1 PREDICTED: extra-large guanine nucleotide-binding... 60 7e-08 XP_014515175.1 PREDICTED: extra-large guanine nucleotide-binding... 60 7e-08 >XP_011625237.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X2 [Amborella trichopoda] Length = 806 Score = 66.2 bits (160), Expect = 5e-10 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 5/67 (7%) Frame = +3 Query: 150 EEKQE--WENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVP 314 EEK E WE +++M PHG + E L+ SIAMEY GPPVPY PKVEPL + S +P Sbjct: 3 EEKDEKTWEGFLKKMLPHGASLPDHERLDYSIAMEYQGPPVPYDPPKVEPLDMS-SATIP 61 Query: 315 TASLAQS 335 ASLA+S Sbjct: 62 PASLAES 68 >XP_006849425.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Amborella trichopoda] ERN11006.1 hypothetical protein AMTR_s00024p00018770 [Amborella trichopoda] Length = 843 Score = 66.2 bits (160), Expect = 5e-10 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 5/67 (7%) Frame = +3 Query: 150 EEKQE--WENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVP 314 EEK E WE +++M PHG + E L+ SIAMEY GPPVPY PKVEPL + S +P Sbjct: 3 EEKDEKTWEGFLKKMLPHGASLPDHERLDYSIAMEYQGPPVPYDPPKVEPLDMS-SATIP 61 Query: 315 TASLAQS 335 ASLA+S Sbjct: 62 PASLAES 68 >XP_017228717.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Daucus carota subsp. sativus] XP_017228722.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Daucus carota subsp. sativus] Length = 856 Score = 62.8 bits (151), Expect = 8e-09 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 4/62 (6%) Frame = +3 Query: 156 KQEWENMMREMFPHGY----TDEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTAS 323 +++W ++R+M P G + DL+ SIAMEY+GPPV Y++PKVEPL VK S + TAS Sbjct: 6 EEDWREIVRKMLPPGAPIPENESDLDYSIAMEYSGPPVSYELPKVEPLDVK-SSSIATAS 64 Query: 324 LA 329 +A Sbjct: 65 MA 66 >XP_010662910.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Vitis vinifera] XP_019080399.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Vitis vinifera] Length = 863 Score = 62.8 bits (151), Expect = 8e-09 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 4/68 (5%) Frame = +3 Query: 150 EEKQEWENMMREMFPHGYT--DE--DLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPT 317 EE W M+ +M P G + DE DL+ SIA+EY GPPV YK+P VEPL V S +PT Sbjct: 2 EEGGNWREMVTKMLPPGASLPDEVSDLDYSIAIEYEGPPVSYKLPTVEPLDVN-SSAIPT 60 Query: 318 ASLAQSLN 341 AS+A++L+ Sbjct: 61 ASIAETLS 68 >OAY30040.1 hypothetical protein MANES_15G192700 [Manihot esculenta] OAY30041.1 hypothetical protein MANES_15G192700 [Manihot esculenta] Length = 860 Score = 62.4 bits (150), Expect = 1e-08 Identities = 31/60 (51%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = +3 Query: 153 EKQEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTA 320 E++ W ++R+M P G D L+ SIA+EY GPPVPYK+PKVEPL V S +PTA Sbjct: 5 EEESWRELVRKMLPPGAPLPDDDTKLDYSIAIEYQGPPVPYKVPKVEPLDVS-SHSIPTA 63 >XP_015574480.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Ricinus communis] XP_015574481.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Ricinus communis] XP_015574482.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Ricinus communis] Length = 861 Score = 62.4 bits (150), Expect = 1e-08 Identities = 31/60 (51%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = +3 Query: 153 EKQEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTA 320 E + W +M++M P G + D L+ SIA+EY GPPVPYK+PKVEPL V S +PTA Sbjct: 5 EGESWRELMKKMLPAGASLPEDDSKLDYSIAIEYEGPPVPYKVPKVEPLDVS-SQAIPTA 63 >EEF43528.1 GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Length = 1203 Score = 62.4 bits (150), Expect = 1e-08 Identities = 31/60 (51%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = +3 Query: 153 EKQEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTA 320 E + W +M++M P G + D L+ SIA+EY GPPVPYK+PKVEPL V S +PTA Sbjct: 5 EGESWRELMKKMLPAGASLPEDDSKLDYSIAIEYEGPPVPYKVPKVEPLDVS-SQAIPTA 63 >XP_012081049.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Jatropha curcas] KDP30366.1 hypothetical protein JCGZ_17095 [Jatropha curcas] Length = 863 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/60 (51%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +3 Query: 153 EKQEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTA 320 E + W +MR+M P G + D L+ SIA+EY GPPVPYK+PKVEPL V +PTA Sbjct: 5 EGEGWRELMRKMLPPGASIPEDDAKLDYSIAIEYEGPPVPYKVPKVEPLDVS-QQSIPTA 63 >XP_019430455.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Lupinus angustifolius] Length = 884 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 4/66 (6%) Frame = +3 Query: 150 EEKQEWENMMREMFPHG--YTDED-LECSIAMEYNGPPVPYKIPKVEPLGVKC-SDDVPT 317 EE ++WE M+R M P G DED L+ S A+EY GPPVPY +P+V+PL + C + T Sbjct: 7 EEDKKWEAMLRRMLPTGAPLPDEDHLDYSFAVEYAGPPVPYDVPRVDPLEIACGGGSIRT 66 Query: 318 ASLAQS 335 S+A S Sbjct: 67 LSIASS 72 >XP_019430454.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Lupinus angustifolius] Length = 885 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 4/66 (6%) Frame = +3 Query: 150 EEKQEWENMMREMFPHG--YTDED-LECSIAMEYNGPPVPYKIPKVEPLGVKC-SDDVPT 317 EE ++WE M+R M P G DED L+ S A+EY GPPVPY +P+V+PL + C + T Sbjct: 7 EEDKKWEAMLRRMLPTGAPLPDEDHLDYSFAVEYAGPPVPYDVPRVDPLEIACGGGSIRT 66 Query: 318 ASLAQS 335 S+A S Sbjct: 67 LSIASS 72 >OIV89926.1 hypothetical protein TanjilG_02117 [Lupinus angustifolius] Length = 888 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 4/66 (6%) Frame = +3 Query: 150 EEKQEWENMMREMFPHG--YTDED-LECSIAMEYNGPPVPYKIPKVEPLGVKC-SDDVPT 317 EE ++WE M+R M P G DED L+ S A+EY GPPVPY +P+V+PL + C + T Sbjct: 7 EEDKKWEAMLRRMLPTGAPLPDEDHLDYSFAVEYAGPPVPYDVPRVDPLEIACGGGSIRT 66 Query: 318 ASLAQS 335 S+A S Sbjct: 67 LSIASS 72 >XP_017223011.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Daucus carota subsp. sativus] Length = 846 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/63 (42%), Positives = 46/63 (73%), Gaps = 4/63 (6%) Frame = +3 Query: 153 EKQEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTA 320 ++++W ++R+M P G ++DL+ SIA+EY+GPPV Y++P+++PL V S +PTA Sbjct: 5 DREDWREVVRKMLPPGAVVPEDEDDLDYSIAIEYSGPPVSYELPRIDPLDVN-SGSIPTA 63 Query: 321 SLA 329 S+A Sbjct: 64 SVA 66 >XP_010276774.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Nelumbo nucifera] Length = 863 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 6/71 (8%) Frame = +3 Query: 150 EEK--QEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDV 311 EEK + W+ ++R+M P G + DL+ SIAMEY GPPV Y++P++EP+ V + + Sbjct: 2 EEKPQENWKELLRKMLPPGASIPDDAADLDYSIAMEYEGPPVSYEVPRIEPIDVN-NPII 60 Query: 312 PTASLAQSLNA 344 PTAS+++ L+A Sbjct: 61 PTASVSEDLSA 71 >XP_010276773.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Nelumbo nucifera] Length = 866 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 6/71 (8%) Frame = +3 Query: 150 EEK--QEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDV 311 EEK + W+ ++R+M P G + DL+ SIAMEY GPPV Y++P++EP+ V + + Sbjct: 2 EEKPQENWKELLRKMLPPGASIPDDAADLDYSIAMEYEGPPVSYEVPRIEPIDVN-NPII 60 Query: 312 PTASLAQSLNA 344 PTAS+++ L+A Sbjct: 61 PTASVSEDLSA 71 >KYP40828.1 Guanine nucleotide-binding protein alpha-2 subunit [Cajanus cajan] Length = 812 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 5/64 (7%) Frame = +3 Query: 150 EEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVP-- 314 EE + WE+++R M P G +E L+ SIA+EY GPPVPY +PKV+PL + + P Sbjct: 7 EEDKSWEHILRRMLPAGAPLPDEEHLDYSIAVEYEGPPVPYDVPKVDPLEISAAAAAPIR 66 Query: 315 TASL 326 TAS+ Sbjct: 67 TASV 70 >KOM54508.1 hypothetical protein LR48_Vigan10g040000 [Vigna angularis] Length = 838 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +3 Query: 132 MDISGNEEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCS 302 M EE + WE+++R M P G +E L+ SIA+EY GPPVPY +PKV+PL + + Sbjct: 1 MASESTEEDKSWEHVLRRMLPAGAPLPDEEHLDYSIAVEYEGPPVPYDVPKVDPLEIGAT 60 Query: 303 DD-----VPTASLAQSLNA 344 + TAS+ NA Sbjct: 61 ASAVAVPIRTASIVSDHNA 79 >XP_017439906.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Vigna angularis] BAU02658.1 hypothetical protein VIGAN_11221500 [Vigna angularis var. angularis] Length = 900 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +3 Query: 132 MDISGNEEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCS 302 M EE + WE+++R M P G +E L+ SIA+EY GPPVPY +PKV+PL + + Sbjct: 1 MASESTEEDKSWEHVLRRMLPAGAPLPDEEHLDYSIAVEYEGPPVPYDVPKVDPLEIGAT 60 Query: 303 DD-----VPTASLAQSLNA 344 + TAS+ NA Sbjct: 61 ASAVAVPIRTASIVSDHNA 79 >XP_017439905.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Vigna angularis] Length = 901 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +3 Query: 132 MDISGNEEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCS 302 M EE + WE+++R M P G +E L+ SIA+EY GPPVPY +PKV+PL + + Sbjct: 1 MASESTEEDKSWEHVLRRMLPAGAPLPDEEHLDYSIAVEYEGPPVPYDVPKVDPLEIGAT 60 Query: 303 DD-----VPTASLAQSLNA 344 + TAS+ NA Sbjct: 61 ASAVAVPIRTASIVSDHNA 79 >XP_014515184.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Vigna radiata var. radiata] Length = 901 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +3 Query: 132 MDISGNEEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCS 302 M EE + WE+++R M P G +E L+ SIA+EY GPPVPY +PKV+PL + + Sbjct: 1 MASESTEEDKSWEHVLRRMLPAGAPLPDEEHLDYSIAVEYEGPPVPYDVPKVDPLEIGAT 60 Query: 303 DD-----VPTASLAQSLNA 344 + TAS+ NA Sbjct: 61 ASAVAVPIRTASIVSDHNA 79 >XP_014515175.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Vigna radiata var. radiata] Length = 902 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +3 Query: 132 MDISGNEEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCS 302 M EE + WE+++R M P G +E L+ SIA+EY GPPVPY +PKV+PL + + Sbjct: 1 MASESTEEDKSWEHVLRRMLPAGAPLPDEEHLDYSIAVEYEGPPVPYDVPKVDPLEIGAT 60 Query: 303 DD-----VPTASLAQSLNA 344 + TAS+ NA Sbjct: 61 ASAVAVPIRTASIVSDHNA 79