BLASTX nr result
ID: Ephedra29_contig00022961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00022961 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009404745.1 PREDICTED: long chain base biosynthesis protein 2... 70 3e-12 XP_019186079.1 PREDICTED: long chain base biosynthesis protein 2... 69 1e-11 XP_010678318.1 PREDICTED: long chain base biosynthesis protein 2... 69 1e-11 JAT60160.1 Serine palmitoyltransferase 2, partial [Anthurium amn... 68 2e-11 XP_017696435.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_009403559.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_018682381.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_010907607.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_010929641.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_008775142.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_008791061.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 OAY67492.1 Long chain base biosynthesis protein 2a [Ananas comosus] 68 2e-11 XP_009421040.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_009403557.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_020112196.1 long chain base biosynthesis protein 2a-like isof... 68 2e-11 XP_020112195.1 long chain base biosynthesis protein 2a-like isof... 68 2e-11 XP_019052308.1 PREDICTED: long chain base biosynthesis protein 2... 68 2e-11 XP_006347368.1 PREDICTED: long chain base biosynthesis protein 2... 66 3e-11 XP_010249161.1 PREDICTED: long chain base biosynthesis protein 2... 68 3e-11 XP_009419359.1 PREDICTED: long chain base biosynthesis protein 2... 67 4e-11 >XP_009404745.1 PREDICTED: long chain base biosynthesis protein 2a-like [Musa acuminata subsp. malaccensis] Length = 489 Score = 70.5 bits (171), Expect = 3e-12 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELCN 133 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELCN Sbjct: 219 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELCN 260 >XP_019186079.1 PREDICTED: long chain base biosynthesis protein 2a [Ipomoea nil] Length = 489 Score = 68.6 bits (166), Expect = 1e-11 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELCN 133 PSHLE++L E IAE QP THRP KK IV+VEGIYSMEGELCN Sbjct: 217 PSHLEKVLREQIAEGQPRTHRPWKKIIVVVEGIYSMEGELCN 258 >XP_010678318.1 PREDICTED: long chain base biosynthesis protein 2a [Beta vulgaris subsp. vulgaris] KMT10893.1 hypothetical protein BVRB_5g113080 [Beta vulgaris subsp. vulgaris] Length = 489 Score = 68.6 bits (166), Expect = 1e-11 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELCN 133 PSHLE++L E IAE QP THRP KK IV+VEGIYSMEGELCN Sbjct: 217 PSHLEKVLREQIAEGQPRTHRPWKKIIVVVEGIYSMEGELCN 258 >JAT60160.1 Serine palmitoyltransferase 2, partial [Anthurium amnicola] Length = 398 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 219 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 259 >XP_017696435.1 PREDICTED: long chain base biosynthesis protein 2a [Phoenix dactylifera] Length = 426 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_009403559.1 PREDICTED: long chain base biosynthesis protein 2a-like isoform X3 [Musa acuminata subsp. malaccensis] XP_018682383.1 PREDICTED: long chain base biosynthesis protein 2a-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 428 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 157 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 197 >XP_018682381.1 PREDICTED: long chain base biosynthesis protein 2a-like isoform X2 [Musa acuminata subsp. malaccensis] XP_018682382.1 PREDICTED: long chain base biosynthesis protein 2a-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 433 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 162 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 202 >XP_010907607.1 PREDICTED: long chain base biosynthesis protein 2a [Elaeis guineensis] Length = 487 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_010929641.1 PREDICTED: long chain base biosynthesis protein 2a-like [Elaeis guineensis] Length = 487 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_008775142.1 PREDICTED: long chain base biosynthesis protein 2a [Phoenix dactylifera] Length = 487 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_008791061.1 PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix dactylifera] Length = 487 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >OAY67492.1 Long chain base biosynthesis protein 2a [Ananas comosus] Length = 488 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_009421040.1 PREDICTED: long chain base biosynthesis protein 2a-like [Musa acuminata subsp. malaccensis] Length = 488 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 219 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 259 >XP_009403557.1 PREDICTED: long chain base biosynthesis protein 2a-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 490 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 219 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 259 >XP_020112196.1 long chain base biosynthesis protein 2a-like isoform X2 [Ananas comosus] XP_020112197.1 long chain base biosynthesis protein 2a-like isoform X2 [Ananas comosus] Length = 493 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_020112195.1 long chain base biosynthesis protein 2a-like isoform X1 [Ananas comosus] Length = 504 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 257 >XP_019052308.1 PREDICTED: long chain base biosynthesis protein 2a isoform X2 [Nelumbo nucifera] Length = 321 Score = 67.8 bits (164), Expect = 2e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IV+VEGIYSMEGELC Sbjct: 49 PSHLEEVLREQIAEGQPRTHRPWKKIIVVVEGIYSMEGELC 89 >XP_006347368.1 PREDICTED: long chain base biosynthesis protein 2a-like [Solanum tuberosum] Length = 489 Score = 65.9 bits (159), Expect(2) = 3e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLE++L E IAE QP THRP KK IV+VEGIYSMEGELC Sbjct: 217 PSHLEKVLREHIAEGQPRTHRPWKKIIVVVEGIYSMEGELC 257 Score = 29.6 bits (65), Expect(2) = 3e-11 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 118 G*IVQLLEIVVVCKKYKARI 177 G + QL EIVV+CKKYKA + Sbjct: 254 GELCQLPEIVVICKKYKAYV 273 >XP_010249161.1 PREDICTED: long chain base biosynthesis protein 2a isoform X1 [Nelumbo nucifera] Length = 489 Score = 67.8 bits (164), Expect = 3e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IV+VEGIYSMEGELC Sbjct: 217 PSHLEEVLREQIAEGQPRTHRPWKKIIVVVEGIYSMEGELC 257 >XP_009419359.1 PREDICTED: long chain base biosynthesis protein 2a [Musa acuminata subsp. malaccensis] Length = 490 Score = 67.4 bits (163), Expect = 4e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 8 PSHLEEMLCESIAERQP*THRP*KKTIVIVEGIYSMEGELC 130 PSHLEE+L E IAE QP THRP KK IVIVEGIYSMEGELC Sbjct: 219 PSHLEEVLRELIAEGQPRTHRPWKKIIVIVEGIYSMEGELC 259