BLASTX nr result
ID: Ephedra29_contig00022663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00022663 (352 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEX12470.1 hypothetical protein 2_10074_01, partial [Pinus taeda] 52 8e-06 >AEX12470.1 hypothetical protein 2_10074_01, partial [Pinus taeda] Length = 141 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/54 (42%), Positives = 36/54 (66%) Frame = -2 Query: 321 KDHGVVYFPSDKSMKSYPPYLLRPAMEWYRNQWFLLSRQDETPTVMEIFENSNV 160 +D VVYFP ++K+YP LRPA EW R +W +L+ QD +P + E+ ++ +V Sbjct: 76 EDLWVVYFPDTCTLKAYPHSELRPAQEWLRGEW-ILAPQDRSPVIEEVIQSLSV 128