BLASTX nr result
ID: Ephedra29_contig00022539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00022539 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS73263.1 farnesyl diphosphate synthase, partial [Genlisea aurea] 49 6e-06 XP_015055138.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 52 7e-06 >EPS73263.1 farnesyl diphosphate synthase, partial [Genlisea aurea] Length = 69 Score = 49.3 bits (116), Expect = 6e-06 Identities = 19/40 (47%), Positives = 30/40 (75%) Frame = +1 Query: 154 DIVSSFVEVYDVLKADILSDPSISYSEEGCKWVYKMLDYN 273 D+ +SF+ VY LK+++L+DPS +S+ KWV +M+DYN Sbjct: 10 DLKASFIGVYSTLKSELLNDPSFEWSDVSLKWVERMMDYN 49 >XP_015055138.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Solanum pennellii] Length = 404 Score = 52.4 bits (124), Expect = 7e-06 Identities = 19/41 (46%), Positives = 34/41 (82%) Frame = +1 Query: 151 NDIVSSFVEVYDVLKADILSDPSISYSEEGCKWVYKMLDYN 273 +D+ S F++VY +LK+++L+DP I ++++G +WV +MLDYN Sbjct: 64 SDLKSKFLDVYKILKSELLNDPDIEFTDDGRQWVERMLDYN 104