BLASTX nr result
ID: Ephedra29_contig00022517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00022517 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AOG18237.1 diterpene synthase [Taiwania cryptomerioides] 59 1e-07 AHW42450.1 CPS1 [Pinus tabuliformis] 56 1e-06 >AOG18237.1 diterpene synthase [Taiwania cryptomerioides] Length = 853 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 342 SLTARLCLAVTRSFYYGAHCTNEEMARHMDMVLFEPV 232 S+ RLCL VT+SFYY AHC N+EMA H+DMVLF P+ Sbjct: 816 SVVKRLCLNVTKSFYYAAHCNNKEMADHVDMVLFHPL 852 >AHW42450.1 CPS1 [Pinus tabuliformis] Length = 796 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 330 RLCLAVTRSFYYGAHCTNEEMARHMDMVLFEPV 232 RLCL V +SFYY AHC NEE+ H++MVLF+PV Sbjct: 763 RLCLVVAKSFYYAAHCNNEEVGNHVEMVLFQPV 795