BLASTX nr result
ID: Ephedra29_contig00022516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00022516 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN17565.1 hypothetical protein AMTR_s00059p00132310 [Amborella ... 81 5e-16 XP_006856098.2 PREDICTED: geranylgeranyl pyrophosphate synthase,... 81 6e-16 AQN80594.1 geranylgeranyl diphosphate synthase 2 [Ginkgo biloba] 79 3e-15 XP_015890229.1 PREDICTED: geranylgeranyl pyrophosphate synthase,... 77 1e-14 XP_020095625.1 heterodimeric geranylgeranyl pyrophosphate syntha... 76 2e-14 OAY83899.1 Heterodimeric geranylgeranyl pyrophosphate synthase l... 76 3e-14 XP_020095615.1 geranylgeranyl pyrophosphate synthase, chloroplas... 76 3e-14 AGL91648.1 geranylgeranyl diphosphate synthase [Catharanthus ros... 76 4e-14 AFJ52722.1 geranyl diphosphate synthase [Mangifera indica] 75 4e-14 ACA21462.1 geranylgeranyl diphosphate synthase 6 [Picea abies] 75 6e-14 CDP07561.1 unnamed protein product [Coffea canephora] 75 7e-14 KVH88447.1 Polyprenyl synthetase [Cynara cardunculus var. scolymus] 75 9e-14 BAE79550.1 geranylgeranyl pyrophosphate synthase [Chrysanthemum ... 75 9e-14 AGU91431.1 geranylgeranyl pyrophosphate synthase [Chrysanthemum ... 75 9e-14 XP_003547995.1 PREDICTED: geranylgeranyl pyrophosphate synthase,... 75 1e-13 KVI02813.1 Polyprenyl synthetase [Cynara cardunculus var. scolymus] 74 2e-13 XP_009415725.1 PREDICTED: geranylgeranyl pyrophosphate synthase ... 74 2e-13 XP_004512007.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 74 2e-13 AIK23240.1 geranyl diphosphate synthase, partial [Pinus massoniana] 74 2e-13 XP_002884145.1 geranylgeranyl diphosphate synthase [Arabidopsis ... 74 2e-13 >ERN17565.1 hypothetical protein AMTR_s00059p00132310 [Amborella trichopoda] Length = 336 Score = 80.9 bits (198), Expect = 5e-16 Identities = 39/71 (54%), Positives = 49/71 (69%) Frame = +2 Query: 41 CTNSTNISFNLSLVLDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGG 220 C ++T + + FDFKGYM+ GN VN ALDK +++ P+ IHEAMRYSLL GG Sbjct: 25 CVSATYLDQKAVETHISEFDFKGYMMEKGNSVNLALDKAVSLREPERIHEAMRYSLLAGG 84 Query: 221 KRVRPRLCIAT 253 KRVRP LCIA+ Sbjct: 85 KRVRPMLCIAS 95 >XP_006856098.2 PREDICTED: geranylgeranyl pyrophosphate synthase, chloroplastic [Amborella trichopoda] Length = 377 Score = 80.9 bits (198), Expect = 6e-16 Identities = 39/71 (54%), Positives = 49/71 (69%) Frame = +2 Query: 41 CTNSTNISFNLSLVLDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGG 220 C ++T + + FDFKGYM+ GN VN ALDK +++ P+ IHEAMRYSLL GG Sbjct: 66 CVSATYLDQKAVETHISEFDFKGYMMEKGNSVNLALDKAVSLREPERIHEAMRYSLLAGG 125 Query: 221 KRVRPRLCIAT 253 KRVRP LCIA+ Sbjct: 126 KRVRPMLCIAS 136 >AQN80594.1 geranylgeranyl diphosphate synthase 2 [Ginkgo biloba] Length = 383 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 92 SFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 SFDFK YMV N +N ALDK ++YP+ IHEAMRYSLL GGKRVRP LCIA Sbjct: 89 SFDFKKYMVLKANAINEALDKSVALRYPEKIHEAMRYSLLAGGKRVRPILCIA 141 >XP_015890229.1 PREDICTED: geranylgeranyl pyrophosphate synthase, chloroplastic-like [Ziziphus jujuba] Length = 361 Score = 77.0 bits (188), Expect = 1e-14 Identities = 37/53 (69%), Positives = 40/53 (75%) Frame = +2 Query: 92 SFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 SFDFK YMV N VN ALD +++PQ IHEAMRYSLL GGKRVRP LCIA Sbjct: 67 SFDFKAYMVQKANSVNKALDDSVLLRHPQKIHEAMRYSLLAGGKRVRPVLCIA 119 >XP_020095625.1 heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic isoform X2 [Ananas comosus] Length = 344 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = +2 Query: 95 FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 FDFKGYMV+ VN ALD + YP+ +HEAMRYSLLGGGKRVRP LC+A Sbjct: 44 FDFKGYMVARAAAVNRALDAAVPVAYPERVHEAMRYSLLGGGKRVRPVLCLA 95 >OAY83899.1 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic [Ananas comosus] Length = 369 Score = 76.3 bits (186), Expect = 3e-14 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = +2 Query: 95 FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 FDFKGYMV+ VN ALD + YP+ +HEAMRYSLLGGGKRVRP LC+A Sbjct: 69 FDFKGYMVARAAAVNRALDAAVPVAYPERVHEAMRYSLLGGGKRVRPVLCLA 120 >XP_020095615.1 geranylgeranyl pyrophosphate synthase, chloroplastic isoform X1 [Ananas comosus] Length = 370 Score = 76.3 bits (186), Expect = 3e-14 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = +2 Query: 95 FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 FDFKGYMV+ VN ALD + YP+ +HEAMRYSLLGGGKRVRP LC+A Sbjct: 70 FDFKGYMVARAAAVNRALDAAVPVAYPERVHEAMRYSLLGGGKRVRPVLCLA 121 >AGL91648.1 geranylgeranyl diphosphate synthase [Catharanthus roseus] Length = 371 Score = 75.9 bits (185), Expect = 4e-14 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = +2 Query: 95 FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 F+FKGYM+ N VN ALD T+K P IHEAMRYSLL GGKRVRP LCIA Sbjct: 78 FNFKGYMIEKANTVNKALDDAVTLKNPPMIHEAMRYSLLAGGKRVRPMLCIA 129 >AFJ52722.1 geranyl diphosphate synthase [Mangifera indica] Length = 328 Score = 75.5 bits (184), Expect = 4e-14 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +2 Query: 95 FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 FDFK YM+ GN VN ALD +I+ P+ IHEAMRYSLL GGKRVRP LCIA Sbjct: 35 FDFKSYMLQKGNSVNQALDAVVSIREPKKIHEAMRYSLLAGGKRVRPVLCIA 86 >ACA21462.1 geranylgeranyl diphosphate synthase 6 [Picea abies] Length = 385 Score = 75.5 bits (184), Expect = 6e-14 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +2 Query: 92 SFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIAT 253 +F+FK YM S N +N ALDK ++++P+ IHEAMRYSLL GGKRVRP LCIA+ Sbjct: 91 AFEFKKYMFSKANAINEALDKCVSLRHPEKIHEAMRYSLLAGGKRVRPILCIAS 144 >CDP07561.1 unnamed protein product [Coffea canephora] Length = 375 Score = 75.1 bits (183), Expect = 7e-14 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = +2 Query: 95 FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 F+FK YMV NIVN ALD ++K P IHEAMRYSLL GGKRVRP LCIA Sbjct: 82 FNFKSYMVEKANIVNKALDDSVSVKNPPKIHEAMRYSLLAGGKRVRPMLCIA 133 >KVH88447.1 Polyprenyl synthetase [Cynara cardunculus var. scolymus] Length = 344 Score = 74.7 bits (182), Expect = 9e-14 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +2 Query: 89 ASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 +SFDFK YM N+VN AL++ +IK P +IHEAMRY+LL GGKRVRP LCIA Sbjct: 59 SSFDFKAYMAEKANLVNKALEESISIKTPPTIHEAMRYTLLAGGKRVRPVLCIA 112 >BAE79550.1 geranylgeranyl pyrophosphate synthase [Chrysanthemum x morifolium] Length = 345 Score = 74.7 bits (182), Expect = 9e-14 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +2 Query: 83 LDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIAT 253 L++ FDFK YMV N VN ALD I+ P+ IHE+MRYSLL GGKRVRP LC+A+ Sbjct: 49 LESEFDFKSYMVQKANTVNQALDDAVPIREPKKIHESMRYSLLAGGKRVRPILCLAS 105 >AGU91431.1 geranylgeranyl pyrophosphate synthase [Chrysanthemum boreale] Length = 345 Score = 74.7 bits (182), Expect = 9e-14 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +2 Query: 83 LDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIAT 253 L++ FDFK YMV N VN ALD I+ P+ IHE+MRYSLL GGKRVRP LC+A+ Sbjct: 49 LESEFDFKSYMVQKANTVNQALDDAVPIREPKKIHESMRYSLLAGGKRVRPILCLAS 105 >XP_003547995.1 PREDICTED: geranylgeranyl pyrophosphate synthase, chloroplastic-like [Glycine max] KRH08315.1 hypothetical protein GLYMA_16G141700 [Glycine max] Length = 367 Score = 74.7 bits (182), Expect = 1e-13 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 11/74 (14%) Frame = +2 Query: 62 SFNLSLVLDAS-----------FDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSL 208 SF LS VL FDFK YMVS + VN ALD +++ PQ IHEAMRYSL Sbjct: 52 SFTLSAVLTKEDTVETEEKPPIFDFKNYMVSKASAVNKALDDAVSLREPQKIHEAMRYSL 111 Query: 209 LGGGKRVRPRLCIA 250 L GGKRVRP LC+A Sbjct: 112 LAGGKRVRPVLCVA 125 >KVI02813.1 Polyprenyl synthetase [Cynara cardunculus var. scolymus] Length = 358 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/56 (62%), Positives = 40/56 (71%) Frame = +2 Query: 83 LDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 L+ FDFK YMV N VN ALD ++K P IHE+MRYSLL GGKR+RP LCIA Sbjct: 62 LEFQFDFKSYMVEKANSVNQALDAAVSLKEPVKIHESMRYSLLAGGKRIRPMLCIA 117 >XP_009415725.1 PREDICTED: geranylgeranyl pyrophosphate synthase 7, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 374 Score = 73.9 bits (180), Expect = 2e-13 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 92 SFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIA 250 +FDFKGYM+ IVN ALD+ + P+ IHEAMRYSLLGGGKR+RP LC+A Sbjct: 74 TFDFKGYMLQKAAIVNRALDEAVPLARPERIHEAMRYSLLGGGKRIRPVLCLA 126 >XP_004512007.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic [Cicer arietinum] Length = 378 Score = 73.9 bits (180), Expect = 2e-13 Identities = 34/62 (54%), Positives = 43/62 (69%) Frame = +2 Query: 68 NLSLVLDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCI 247 N+ +F+F YM+ NIVN ALD+ +K P+ IHEAMRYSLL GGKR+RP LC+ Sbjct: 76 NIEEETTTNFNFNAYMLEKANIVNKALDEAIVLKEPEKIHEAMRYSLLAGGKRIRPILCL 135 Query: 248 AT 253 AT Sbjct: 136 AT 137 >AIK23240.1 geranyl diphosphate synthase, partial [Pinus massoniana] Length = 385 Score = 73.9 bits (180), Expect = 2e-13 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 92 SFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEAMRYSLLGGGKRVRPRLCIAT 253 +F+FK YM S N +N ALDK ++++P IHEAMRYSLL GGKRVRP LCIA+ Sbjct: 91 AFEFKKYMFSKANAINEALDKSVSLRHPGKIHEAMRYSLLAGGKRVRPILCIAS 144 >XP_002884145.1 geranylgeranyl diphosphate synthase [Arabidopsis lyrata subsp. lyrata] EFH60404.1 geranylgeranyl diphosphate synthase [Arabidopsis lyrata subsp. lyrata] Length = 329 Score = 73.6 bits (179), Expect = 2e-13 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 10/79 (12%) Frame = +2 Query: 44 TNSTNISFNLSLV----------LDASFDFKGYMVSMGNIVNTALDKYCTIKYPQSIHEA 193 ++ +N+SF+LS V + FDF YM+ N VN ALD +++ P IHEA Sbjct: 22 SSKSNLSFSLSTVSSVVTGEESIIHDKFDFMSYMIGKANSVNKALDSAVSLREPIKIHEA 81 Query: 194 MRYSLLGGGKRVRPRLCIA 250 MRYSLL GGKRVRP LCIA Sbjct: 82 MRYSLLAGGKRVRPVLCIA 100