BLASTX nr result
ID: Ephedra29_contig00021782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00021782 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACJ83334.1 unknown, partial [Medicago truncatula] 79 1e-15 XP_013458307.1 AMSH-like ubiquitin thioesterase-like protein [Me... 79 1e-14 XP_013458306.1 AMSH-like ubiquitin thioesterase-like protein [Me... 79 1e-14 XP_003609726.1 AMSH-like ubiquitin thioesterase-like protein [Me... 79 1e-14 GAU37464.1 hypothetical protein TSUD_207000 [Trifolium subterran... 76 1e-14 KRH50768.1 hypothetical protein GLYMA_07G242500 [Glycine max] 77 3e-14 KHN02918.1 AMSH-like ubiquitin thioesterase 3 [Glycine soja] 77 3e-14 XP_006584010.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Gl... 77 3e-14 XP_012573425.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 iso... 77 4e-14 XP_004508167.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 iso... 77 4e-14 XP_010024772.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 iso... 77 6e-14 XP_010024771.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 iso... 77 6e-14 XP_016197910.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Ar... 76 8e-14 XP_015937348.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Ar... 76 8e-14 KOM33453.1 hypothetical protein LR48_Vigan01g300900 [Vigna angul... 76 1e-13 XP_017409772.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Vi... 76 1e-13 XP_014510053.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Vi... 76 1e-13 KRH02325.1 hypothetical protein GLYMA_17G031700 [Glycine max] 75 1e-13 XP_003550553.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Gl... 75 1e-13 XP_020113785.1 AMSH-like ubiquitin thioesterase 3 [Ananas comosus] 75 1e-13 >ACJ83334.1 unknown, partial [Medicago truncatula] Length = 199 Score = 78.6 bits (192), Expect = 1e-15 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD +L +A YREEN +++L+ MLLRF+SL++ I YHRDYQ +NE+AAY K+ VL Sbjct: 27 ADSLLKQARVYREENNVVDLYIMLLRFISLVSETIPYHRDYQATLANERAAYKKRSRLVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_013458307.1 AMSH-like ubiquitin thioesterase-like protein [Medicago truncatula] KEH32338.1 AMSH-like ubiquitin thioesterase-like protein [Medicago truncatula] Length = 391 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD +L +A YREEN +++L+ MLLRF+SL++ I YHRDYQ +NE+AAY K+ VL Sbjct: 27 ADSLLKQARVYREENNVVDLYIMLLRFISLVSETIPYHRDYQATLANERAAYKKRSRLVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_013458306.1 AMSH-like ubiquitin thioesterase-like protein [Medicago truncatula] KEH32337.1 AMSH-like ubiquitin thioesterase-like protein [Medicago truncatula] Length = 427 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD +L +A YREEN +++L+ MLLRF+SL++ I YHRDYQ +NE+AAY K+ VL Sbjct: 27 ADSLLKQARVYREENNVVDLYIMLLRFISLVSETIPYHRDYQATLANERAAYKKRSRLVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_003609726.1 AMSH-like ubiquitin thioesterase-like protein [Medicago truncatula] AES91923.1 AMSH-like ubiquitin thioesterase-like protein [Medicago truncatula] Length = 509 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD +L +A YREEN +++L+ MLLRF+SL++ I YHRDYQ +NE+AAY K+ VL Sbjct: 27 ADSLLKQARVYREENNVVDLYIMLLRFISLVSETIPYHRDYQATLANERAAYKKRSRLVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >GAU37464.1 hypothetical protein TSUD_207000 [Trifolium subterraneum] Length = 218 Score = 76.3 bits (186), Expect = 1e-14 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN I++L+ +LLRF+SL++ I YHRDYQ NE+ AY ++ VL Sbjct: 27 ADNLLKQASVYREENNIVDLYIILLRFISLVSETIPYHRDYQASLPNERTAYKRRSLLVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >KRH50768.1 hypothetical protein GLYMA_07G242500 [Glycine max] Length = 420 Score = 77.4 bits (189), Expect = 3e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +A+ YREEN +++L+ +LLRF+SL++ I YHRDYQ NE+AAY K+ VL Sbjct: 27 ADNLLKQATIYREENNVVDLYIILLRFLSLVSETIPYHRDYQASLPNERAAYKKRSRAVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >KHN02918.1 AMSH-like ubiquitin thioesterase 3 [Glycine soja] Length = 504 Score = 77.4 bits (189), Expect = 3e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +A+ YREEN +++L+ +LLRF+SL++ I YHRDYQ NE+AAY K+ VL Sbjct: 27 ADNLLKQATIYREENNVVDLYIILLRFLSLVSETIPYHRDYQASLPNERAAYKKRSRAVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_006584010.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Glycine max] KRH50767.1 hypothetical protein GLYMA_07G242500 [Glycine max] Length = 504 Score = 77.4 bits (189), Expect = 3e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +A+ YREEN +++L+ +LLRF+SL++ I YHRDYQ NE+AAY K+ VL Sbjct: 27 ADNLLKQATIYREENNVVDLYIILLRFLSLVSETIPYHRDYQASLPNERAAYKKRSRAVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_012573425.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 isoform X2 [Cicer arietinum] Length = 437 Score = 77.0 bits (188), Expect = 4e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN I++L+ +LLRF+SL++ I YHRDYQ NE+AAY ++ VL Sbjct: 27 ADNLLKQASVYREENNIVDLYIILLRFISLVSETIPYHRDYQTSLPNERAAYKRRSRLVL 86 Query: 34 MELEELKP 11 ELE +KP Sbjct: 87 DELESVKP 94 >XP_004508167.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 isoform X1 [Cicer arietinum] Length = 506 Score = 77.0 bits (188), Expect = 4e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN I++L+ +LLRF+SL++ I YHRDYQ NE+AAY ++ VL Sbjct: 27 ADNLLKQASVYREENNIVDLYIILLRFISLVSETIPYHRDYQTSLPNERAAYKRRSRLVL 86 Query: 34 MELEELKP 11 ELE +KP Sbjct: 87 DELESVKP 94 >XP_010024772.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 isoform X2 [Eucalyptus grandis] KCW61266.1 hypothetical protein EUGRSUZ_H04029 [Eucalyptus grandis] Length = 513 Score = 76.6 bits (187), Expect = 6e-14 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN I++L+ +LLRF SL++ I +HRDYQ E++ Y KKL DV+ Sbjct: 27 ADNLLKQASVYREENNIVDLYIILLRFSSLVSETIPFHRDYQLLRPKERSIYRKKLFDVV 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 AELESLKP 94 >XP_010024771.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 isoform X1 [Eucalyptus grandis] KCW61267.1 hypothetical protein EUGRSUZ_H04029 [Eucalyptus grandis] Length = 520 Score = 76.6 bits (187), Expect = 6e-14 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN I++L+ +LLRF SL++ I +HRDYQ E++ Y KKL DV+ Sbjct: 27 ADNLLKQASVYREENNIVDLYIILLRFSSLVSETIPFHRDYQLLRPKERSIYRKKLFDVV 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 AELESLKP 94 >XP_016197910.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Arachis ipaensis] Length = 511 Score = 76.3 bits (186), Expect = 8e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YR+EN I++L+ +LLRF SL++ I YHRDYQ NE+AAY K+L V+ Sbjct: 27 ADNLLKQASIYRQENNIVDLYIILLRFSSLVSETIPYHRDYQASLHNERAAYKKRLLAVI 86 Query: 34 MELEELKP 11 ELE L+P Sbjct: 87 DELEALRP 94 >XP_015937348.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Arachis duranensis] Length = 511 Score = 76.3 bits (186), Expect = 8e-14 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YR+EN I++L+ +LLRF SL++ I YHRDYQ NE+AAY K+L V+ Sbjct: 27 ADNLLKQASIYRQENNIVDLYIILLRFSSLVSETIPYHRDYQASLHNERAAYKKRLLAVI 86 Query: 34 MELEELKP 11 ELE L+P Sbjct: 87 DELEALRP 94 >KOM33453.1 hypothetical protein LR48_Vigan01g300900 [Vigna angularis] Length = 490 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/68 (52%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN +++L+ +L+RF+SL++ I YHRDY NE+AAY K+ VL Sbjct: 27 ADNLLKQASIYREENNVVDLYIILVRFLSLVSETIPYHRDYHASLPNERAAYKKRSRPVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_017409772.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Vigna angularis] BAT77077.1 hypothetical protein VIGAN_01516500 [Vigna angularis var. angularis] Length = 511 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/68 (52%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN +++L+ +L+RF+SL++ I YHRDY NE+AAY K+ VL Sbjct: 27 ADNLLKQASIYREENNVVDLYIILVRFLSLVSETIPYHRDYHASLPNERAAYKKRSRPVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_014510053.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Vigna radiata var. radiata] Length = 511 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/68 (52%), Positives = 50/68 (73%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +AS YREEN +++L+ +L+RF+SL++ I YHRDY NE+AAY K+ VL Sbjct: 27 ADNLLKQASIYREENNVVDLYIILVRFLSLVSETIPYHRDYHASLPNERAAYKKRSRPVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >KRH02325.1 hypothetical protein GLYMA_17G031700 [Glycine max] Length = 372 Score = 75.5 bits (184), Expect = 1e-13 Identities = 36/68 (52%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +A+ YREE+ +++L+ +LLRF+SL++ I YHRDYQ NE+AAY K+ VL Sbjct: 27 ADNLLKQATIYREEHNVVDLYIILLRFLSLVSETIPYHRDYQASLPNERAAYKKRSRAVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_003550553.1 PREDICTED: AMSH-like ubiquitin thioesterase 3 [Glycine max] KHN03314.1 AMSH-like ubiquitin thioesterase 3 [Glycine soja] KRH02324.1 hypothetical protein GLYMA_17G031700 [Glycine max] Length = 504 Score = 75.5 bits (184), Expect = 1e-13 Identities = 36/68 (52%), Positives = 51/68 (75%) Frame = -3 Query: 214 ADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAAYDKKLSDVL 35 AD++L +A+ YREE+ +++L+ +LLRF+SL++ I YHRDYQ NE+AAY K+ VL Sbjct: 27 ADNLLKQATIYREEHNVVDLYIILLRFLSLVSETIPYHRDYQASLPNERAAYKKRSRAVL 86 Query: 34 MELEELKP 11 ELE LKP Sbjct: 87 DELESLKP 94 >XP_020113785.1 AMSH-like ubiquitin thioesterase 3 [Ananas comosus] Length = 508 Score = 75.5 bits (184), Expect = 1e-13 Identities = 40/77 (51%), Positives = 53/77 (68%) Frame = -3 Query: 241 ISLPDLFVAADDMLTKASTYREENKIIELHSMLLRFVSLLTVNIQYHRDYQKHHSNEKAA 62 ISL + AD++L +AS YREE +I+L+ +LLRF SL+ I HRDYQ + EKA Sbjct: 23 ISLHYYYRIADNLLKQASIYREEKNLIDLYIILLRFSSLMCETIPSHRDYQAFNLKEKAI 82 Query: 61 YDKKLSDVLMELEELKP 11 + KKL DV+ ELE+LKP Sbjct: 83 FKKKLWDVINELEKLKP 99