BLASTX nr result
ID: Ephedra29_contig00021521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00021521 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009398388.1 PREDICTED: thioredoxin H1-like [Musa acuminata su... 114 2e-30 XP_019240826.1 PREDICTED: thioredoxin H2-like [Nicotiana attenua... 114 3e-30 AAU93947.1 thioredoxin H [Helicosporidium sp. ex Simulium jonesi] 113 5e-30 XP_015074538.1 PREDICTED: thioredoxin H4-like [Solanum pennellii] 113 7e-30 XP_004238753.1 PREDICTED: thioredoxin H4 [Solanum lycopersicum] 113 7e-30 XP_009592735.1 PREDICTED: thioredoxin H2-like [Nicotiana tomento... 113 7e-30 XP_016701300.1 PREDICTED: thioredoxin H1-like [Gossypium hirsutu... 112 9e-30 XP_020095590.1 thioredoxin H1-like [Ananas comosus] OAY82511.1 T... 112 1e-29 XP_016433065.1 PREDICTED: thioredoxin H2-like [Nicotiana tabacum] 113 1e-29 XP_009803170.1 PREDICTED: thioredoxin H2-like [Nicotiana sylvest... 112 1e-29 XP_009614882.1 PREDICTED: thioredoxin H2-like [Nicotiana tomento... 112 2e-29 XP_002183039.1 thioredoxin h [Phaeodactylum tricornutum CCAP 105... 112 5e-29 XP_009783477.1 PREDICTED: thioredoxin H2-like [Nicotiana sylvest... 110 8e-29 XP_019238195.1 PREDICTED: thioredoxin H2-like [Nicotiana attenua... 110 1e-28 XP_012466262.1 PREDICTED: thioredoxin H1-like [Gossypium raimond... 109 2e-28 XP_015074540.1 PREDICTED: thioredoxin H4-like [Solanum pennellii] 109 2e-28 XP_015969666.1 PREDICTED: thioredoxin H1-like [Arachis duranensi... 108 3e-28 XP_004238755.1 PREDICTED: thioredoxin H4 isoform X1 [Solanum lyc... 109 3e-28 XP_009758326.1 PREDICTED: thioredoxin H4-like [Nicotiana sylvest... 109 4e-28 XP_009758325.1 PREDICTED: thioredoxin H4-like [Nicotiana sylvest... 109 4e-28 >XP_009398388.1 PREDICTED: thioredoxin H1-like [Musa acuminata subsp. malaccensis] Length = 114 Score = 114 bits (285), Expect = 2e-30 Identities = 50/84 (59%), Positives = 64/84 (76%) Frame = +2 Query: 14 KLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTFIFM 193 KLVV+DFTA+WCGPCR I PIF A+ YPN+IFLKVDVDE+ ++ED+ + AMPTFIF+ Sbjct: 28 KLVVIDFTASWCGPCRAIAPIFADLAKRYPNVIFLKVDVDELKPVAEDWAIEAMPTFIFL 87 Query: 194 KGGVVVDNIRGANPARLKEKVEAH 265 K G +VD I GA+ L ++E H Sbjct: 88 KEGTIVDKIVGAHKDELPRRIELH 111 >XP_019240826.1 PREDICTED: thioredoxin H2-like [Nicotiana attenuata] OIT19951.1 thioredoxin h2 [Nicotiana attenuata] Length = 136 Score = 114 bits (286), Expect = 3e-30 Identities = 50/88 (56%), Positives = 69/88 (78%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+ +EP+ FA Y ++ F+K+DVDE+AK++E+YGV AMPT Sbjct: 44 KDTNKLVVIDFTATWCGPCKYMEPVINDFAAKYTDVEFVKIDVDELAKVAEEYGVQAMPT 103 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 104 FVLIKKGKVVDKVVGADKDGLKKKIEKH 131 >AAU93947.1 thioredoxin H [Helicosporidium sp. ex Simulium jonesi] Length = 112 Score = 113 bits (282), Expect = 5e-30 Identities = 48/89 (53%), Positives = 68/89 (76%) Frame = +2 Query: 5 NENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTF 184 ++ KLVVVDFTATWCGPC+ I P F K + +YP+++FLKVDVDE+ ++ ++G+TAMPTF Sbjct: 23 SKGKLVVVDFTATWCGPCKMIAPFFAKLSGEYPDVVFLKVDVDEVEAVAAEHGITAMPTF 82 Query: 185 IFMKGGVVVDNIRGANPARLKEKVEAHSQ 271 +F K G VD++ GAN RL+ + H+Q Sbjct: 83 LFFKDGKQVDSLTGANQERLRAMLTQHAQ 111 >XP_015074538.1 PREDICTED: thioredoxin H4-like [Solanum pennellii] Length = 135 Score = 113 bits (283), Expect = 7e-30 Identities = 52/88 (59%), Positives = 65/88 (73%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPCR ++PI FA Y N+ F+K+DVDE+ ++E YGV AMPT Sbjct: 43 KDTNKLVVIDFTATWCGPCRNMDPIINDFAAKYTNVEFVKIDVDELVDVAEKYGVQAMPT 102 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ MK G VVD I GA+ LK K+E H Sbjct: 103 FVLMKKGEVVDQIVGADKDGLKMKIEKH 130 >XP_004238753.1 PREDICTED: thioredoxin H4 [Solanum lycopersicum] Length = 135 Score = 113 bits (283), Expect = 7e-30 Identities = 52/88 (59%), Positives = 65/88 (73%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPCR ++PI FA Y N+ F+K+DVDE+ ++E YGV AMPT Sbjct: 43 KDTNKLVVIDFTATWCGPCRNMDPIINDFAAKYTNVEFVKIDVDELVDVAEKYGVQAMPT 102 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ MK G VVD I GA+ LK K+E H Sbjct: 103 FVLMKKGEVVDQIVGADKDGLKMKIEKH 130 >XP_009592735.1 PREDICTED: thioredoxin H2-like [Nicotiana tomentosiformis] XP_016433066.1 PREDICTED: thioredoxin H2-like [Nicotiana tabacum] Length = 136 Score = 113 bits (283), Expect = 7e-30 Identities = 49/88 (55%), Positives = 68/88 (77%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTA WCGPC+ IEP+ FA Y ++ F+K+DVDE+AK++E+YGV AMPT Sbjct: 44 KDTNKLVVIDFTAAWCGPCKYIEPVINDFAAKYTDVEFVKIDVDELAKVAEEYGVQAMPT 103 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G V+D + GA+ LK+K+E H Sbjct: 104 FVLIKKGKVIDKVVGADKDGLKKKIEKH 131 >XP_016701300.1 PREDICTED: thioredoxin H1-like [Gossypium hirsutum] XP_017640557.1 PREDICTED: thioredoxin H1-like [Gossypium arboreum] KHG18714.1 Thioredoxin H-type [Gossypium arboreum] Length = 119 Score = 112 bits (281), Expect = 9e-30 Identities = 48/86 (55%), Positives = 65/86 (75%) Frame = +2 Query: 11 NKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTFIF 190 NKLVVVDFTA+WCGPCR I PI V A+ PN+IFLKVDVDE+ +++ + + AMPTF+F Sbjct: 27 NKLVVVDFTASWCGPCRFISPILVDLAKKLPNVIFLKVDVDELKSVAQSWAIEAMPTFVF 86 Query: 191 MKGGVVVDNIRGANPARLKEKVEAHS 268 +KGG ++D + GA L++K+ HS Sbjct: 87 LKGGTIIDKLVGARKDELQQKIAFHS 112 >XP_020095590.1 thioredoxin H1-like [Ananas comosus] OAY82511.1 Thioredoxin H1 [Ananas comosus] Length = 114 Score = 112 bits (280), Expect = 1e-29 Identities = 47/82 (57%), Positives = 65/82 (79%) Frame = +2 Query: 14 KLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTFIFM 193 KLVVVDFTA+WC PCR I P+F +FA+ YPN+IFLKVDVDE+ +++D+ + AMPTF+F+ Sbjct: 28 KLVVVDFTASWCPPCRMIAPVFAEFAKKYPNVIFLKVDVDELKSVAQDWAIEAMPTFVFL 87 Query: 194 KGGVVVDNIRGANPARLKEKVE 259 K G +VD + GA L++K+E Sbjct: 88 KEGTIVDKVVGAKKEELQKKIE 109 >XP_016433065.1 PREDICTED: thioredoxin H2-like [Nicotiana tabacum] Length = 140 Score = 113 bits (282), Expect = 1e-29 Identities = 49/88 (55%), Positives = 68/88 (77%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+ +EP+ FA Y ++ F+K+DVDE+ K++E+YGV AMPT Sbjct: 48 KDTNKLVVIDFTATWCGPCKNMEPVINDFAAKYTDVEFVKIDVDELDKVAEEYGVQAMPT 107 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 108 FVLIKKGKVVDKVVGADKDGLKKKIEKH 135 >XP_009803170.1 PREDICTED: thioredoxin H2-like [Nicotiana sylvestris] XP_016478272.1 PREDICTED: thioredoxin H2-like [Nicotiana tabacum] Length = 136 Score = 112 bits (281), Expect = 1e-29 Identities = 50/88 (56%), Positives = 68/88 (77%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+ +EPI FA Y ++ F+K+DVDE+ K++E+YGV AMPT Sbjct: 44 KDTNKLVVIDFTATWCGPCKYMEPIMNDFAAKYTDVEFVKIDVDELDKVAEEYGVQAMPT 103 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 104 FVLIKKGKVVDKVVGADKDGLKKKIEKH 131 >XP_009614882.1 PREDICTED: thioredoxin H2-like [Nicotiana tomentosiformis] Length = 140 Score = 112 bits (281), Expect = 2e-29 Identities = 48/88 (54%), Positives = 68/88 (77%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKL+V+DFTATWCGPC+ +EP+ FA Y ++ F+K+DVDE+ K++E+YGV AMPT Sbjct: 48 KDTNKLIVIDFTATWCGPCKNMEPVINDFAAKYTDVEFVKIDVDELDKVAEEYGVQAMPT 107 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 108 FVLIKKGKVVDKVVGADKDGLKKKIEKH 135 >XP_002183039.1 thioredoxin h [Phaeodactylum tricornutum CCAP 1055/1] EEC45257.1 thioredoxin h [Phaeodactylum tricornutum CCAP 1055/1] Length = 165 Score = 112 bits (280), Expect = 5e-29 Identities = 46/87 (52%), Positives = 66/87 (75%) Frame = +2 Query: 5 NENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTF 184 +E KLVV+DF+ATWCGPC+ I P+F + +E P ++F+K+DVDE + Y V+AMPTF Sbjct: 78 SEGKLVVIDFSATWCGPCKMIAPLFQQLSEAIPGVVFIKIDVDENPDTAAKYNVSAMPTF 137 Query: 185 IFMKGGVVVDNIRGANPARLKEKVEAH 265 +F+K G V+D + GANPARL+E ++ H Sbjct: 138 VFLKSGEVIDRLMGANPARLQELIDEH 164 >XP_009783477.1 PREDICTED: thioredoxin H2-like [Nicotiana sylvestris] XP_016506325.1 PREDICTED: thioredoxin H2-like [Nicotiana tabacum] Length = 135 Score = 110 bits (276), Expect = 8e-29 Identities = 47/88 (53%), Positives = 68/88 (77%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+T+EP+ FA Y ++ F+K+DVDE+A ++++YGV AMPT Sbjct: 43 KDTNKLVVIDFTATWCGPCKTMEPVINDFAAKYTDVEFVKIDVDELADVAQEYGVQAMPT 102 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ ++ G VD + GA+ LK+K+E H Sbjct: 103 FVLIRKGKFVDKVVGADKDGLKKKIEKH 130 >XP_019238195.1 PREDICTED: thioredoxin H2-like [Nicotiana attenuata] OIT21894.1 thioredoxin h2 [Nicotiana attenuata] Length = 140 Score = 110 bits (275), Expect = 1e-28 Identities = 47/88 (53%), Positives = 67/88 (76%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+ +EP+ +A Y ++ F+K+DVDE+ K++E+YGV MPT Sbjct: 48 KDTNKLVVIDFTATWCGPCKNMEPVINDYAAKYTDVEFVKIDVDELDKVAEEYGVQTMPT 107 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 108 FVLIKKGKVVDKVVGADKDGLKKKIEKH 135 >XP_012466262.1 PREDICTED: thioredoxin H1-like [Gossypium raimondii] XP_016742028.1 PREDICTED: thioredoxin H1-like [Gossypium hirsutum] KJB14466.1 hypothetical protein B456_002G126200 [Gossypium raimondii] Length = 119 Score = 109 bits (272), Expect = 2e-28 Identities = 47/88 (53%), Positives = 65/88 (73%) Frame = +2 Query: 14 KLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTFIFM 193 KLVVVDFTA+WCGPCR I PI V A+ PN+IFLKVDVDE+ +++++ + AMPTF+F+ Sbjct: 28 KLVVVDFTASWCGPCRFISPILVDLAKKLPNVIFLKVDVDELNTVAQEWAIEAMPTFVFL 87 Query: 194 KGGVVVDNIRGANPARLKEKVEAHSQ*P 277 K G ++D + GA L++K+ HS P Sbjct: 88 KEGTIIDKVVGARKEELQQKIAFHSSNP 115 >XP_015074540.1 PREDICTED: thioredoxin H4-like [Solanum pennellii] Length = 135 Score = 109 bits (273), Expect = 2e-28 Identities = 50/88 (56%), Positives = 66/88 (75%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 KN NKLVV+DFTATWCGPC+ +EPI FA Y ++ F+K+DVDE+ ++++YGV AMPT Sbjct: 43 KNTNKLVVIDFTATWCGPCKYMEPILNDFAAKYIDVEFVKIDVDELDDVAQEYGVQAMPT 102 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD I GA+ LK K+E H Sbjct: 103 FVLIKKGKVVDKIVGADKDGLKMKIEKH 130 >XP_015969666.1 PREDICTED: thioredoxin H1-like [Arachis duranensis] XP_016204758.1 PREDICTED: thioredoxin H1-like [Arachis ipaensis] Length = 114 Score = 108 bits (271), Expect = 3e-28 Identities = 50/88 (56%), Positives = 61/88 (69%) Frame = +2 Query: 5 NENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPTF 184 + KLV VDFTATWCGPCR I P+F A+ PN+IFLKVDVDEM ++E++GV AMPTF Sbjct: 24 DSKKLVAVDFTATWCGPCRFIGPVFADLAKKTPNVIFLKVDVDEMRDIAEEWGVEAMPTF 83 Query: 185 IFMKGGVVVDNIRGANPARLKEKVEAHS 268 IF K G VD + GA L+ + HS Sbjct: 84 IFFKEGKAVDRVVGAKKEELEHAIAKHS 111 >XP_004238755.1 PREDICTED: thioredoxin H4 isoform X1 [Solanum lycopersicum] Length = 135 Score = 109 bits (272), Expect = 3e-28 Identities = 49/88 (55%), Positives = 66/88 (75%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 KN NKLVV+DFTATWCGPC+ +EPI FA Y ++ F+K+DVDE+ ++++YGV AMPT Sbjct: 43 KNTNKLVVIDFTATWCGPCKYMEPILNDFAAKYIDVEFVKIDVDELDDVAQEYGVQAMPT 102 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK K+E H Sbjct: 103 FVLIKKGKVVDKVVGADKDGLKMKIEKH 130 >XP_009758326.1 PREDICTED: thioredoxin H4-like [Nicotiana sylvestris] XP_016432703.1 PREDICTED: thioredoxin H4-like [Nicotiana tabacum] Length = 140 Score = 109 bits (272), Expect = 4e-28 Identities = 47/88 (53%), Positives = 66/88 (75%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+ +EP+ A Y ++ F+K+DVDE+ K++E+YGV MPT Sbjct: 48 KDTNKLVVIDFTATWCGPCKNMEPVMNDLAAKYTDVEFVKIDVDELDKVAEEYGVQTMPT 107 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 108 FVLIKKGEVVDKVVGADKDGLKKKIEKH 135 >XP_009758325.1 PREDICTED: thioredoxin H4-like [Nicotiana sylvestris] XP_016432704.1 PREDICTED: thioredoxin H4-like [Nicotiana tabacum] Length = 140 Score = 109 bits (272), Expect = 4e-28 Identities = 47/88 (53%), Positives = 66/88 (75%) Frame = +2 Query: 2 KNENKLVVVDFTATWCGPCRTIEPIFVKFAEDYPNIIFLKVDVDEMAKLSEDYGVTAMPT 181 K+ NKLVV+DFTATWCGPC+ +EP+ A Y ++ F+K+DVDE+ K++E+YGV MPT Sbjct: 48 KDTNKLVVIDFTATWCGPCKNMEPVMNDLAAKYTDVEFVKIDVDELDKVAEEYGVQTMPT 107 Query: 182 FIFMKGGVVVDNIRGANPARLKEKVEAH 265 F+ +K G VVD + GA+ LK+K+E H Sbjct: 108 FVLIKKGEVVDKVVGADKDGLKKKIEKH 135