BLASTX nr result
ID: Ephedra29_contig00021465
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00021465 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011021754.1 PREDICTED: MACPF domain-containing protein At1g14... 84 3e-16 XP_011021752.1 PREDICTED: MACPF domain-containing protein At1g14... 84 3e-16 XP_002314778.2 hypothetical protein POPTR_0010s11530g [Populus t... 84 3e-16 OAY25327.1 hypothetical protein MANES_17G085300 [Manihot esculenta] 83 4e-16 OAY25328.1 hypothetical protein MANES_17G085300 [Manihot esculenta] 83 4e-16 KDO60794.1 hypothetical protein CISIN_1g006910mg [Citrus sinensis] 83 6e-16 XP_006469267.1 PREDICTED: MACPF domain-containing protein At1g14... 83 6e-16 CDP05572.1 unnamed protein product [Coffea canephora] 82 8e-16 XP_006448143.1 hypothetical protein CICLE_v10014601mg [Citrus cl... 82 1e-15 XP_012072333.1 PREDICTED: MACPF domain-containing protein At1g14... 82 1e-15 OAY29323.1 hypothetical protein MANES_15G136000 [Manihot esculenta] 82 1e-15 XP_002312471.2 hypothetical protein POPTR_0008s13580g [Populus t... 82 1e-15 EEF29192.1 conserved hypothetical protein [Ricinus communis] 80 2e-15 XP_006849790.1 PREDICTED: MACPF domain-containing protein At1g14... 81 3e-15 XP_019176523.1 PREDICTED: MACPF domain-containing protein At1g14... 81 3e-15 KCW63934.1 hypothetical protein EUGRSUZ_G01611 [Eucalyptus grandis] 78 4e-15 XP_011024349.1 PREDICTED: MACPF domain-containing protein At1g14... 80 5e-15 XP_018837919.1 PREDICTED: MACPF domain-containing protein At1g14... 80 5e-15 XP_011024339.1 PREDICTED: MACPF domain-containing protein At1g14... 80 5e-15 XP_002533200.2 PREDICTED: MACPF domain-containing protein At1g14... 80 7e-15 >XP_011021754.1 PREDICTED: MACPF domain-containing protein At1g14780 isoform X2 [Populus euphratica] Length = 516 Score = 83.6 bits (205), Expect = 3e-16 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 KLL +VD+S++C+GPQD+PGHWLVTGA+LD+DKGKISLQVKFSLL Sbjct: 468 KLLKFVDTSQLCRGPQDSPGHWLVTGARLDLDKGKISLQVKFSLL 512 >XP_011021752.1 PREDICTED: MACPF domain-containing protein At1g14780 isoform X1 [Populus euphratica] Length = 596 Score = 83.6 bits (205), Expect = 3e-16 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 KLL +VD+S++C+GPQD+PGHWLVTGA+LD+DKGKISLQVKFSLL Sbjct: 548 KLLKFVDTSQLCRGPQDSPGHWLVTGARLDLDKGKISLQVKFSLL 592 >XP_002314778.2 hypothetical protein POPTR_0010s11530g [Populus trichocarpa] EEF00949.2 hypothetical protein POPTR_0010s11530g [Populus trichocarpa] Length = 596 Score = 83.6 bits (205), Expect = 3e-16 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 KLL +VD+S++C+GPQD+PGHWLVTGA+LD+DKGKISLQVKFSLL Sbjct: 548 KLLKFVDTSQLCRGPQDSPGHWLVTGARLDLDKGKISLQVKFSLL 592 >OAY25327.1 hypothetical protein MANES_17G085300 [Manihot esculenta] Length = 516 Score = 83.2 bits (204), Expect = 4e-16 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD S++C+GPQD PGHWLVTGAKLD+D+GKI LQVKFSLL C Sbjct: 468 KLLKFVDVSQLCRGPQDCPGHWLVTGAKLDLDRGKICLQVKFSLLNIC 515 >OAY25328.1 hypothetical protein MANES_17G085300 [Manihot esculenta] Length = 595 Score = 83.2 bits (204), Expect = 4e-16 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD S++C+GPQD PGHWLVTGAKLD+D+GKI LQVKFSLL C Sbjct: 547 KLLKFVDVSQLCRGPQDCPGHWLVTGAKLDLDRGKICLQVKFSLLNIC 594 >KDO60794.1 hypothetical protein CISIN_1g006910mg [Citrus sinensis] Length = 626 Score = 82.8 bits (203), Expect = 6e-16 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD+S++C+GPQD+PGHWLVTGAKLD++KGKI L+VKFSLL C Sbjct: 578 KLLKFVDTSQLCRGPQDSPGHWLVTGAKLDLEKGKICLRVKFSLLNIC 625 >XP_006469267.1 PREDICTED: MACPF domain-containing protein At1g14780 [Citrus sinensis] Length = 626 Score = 82.8 bits (203), Expect = 6e-16 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD+S++C+GPQD+PGHWLVTGAKLD++KGKI L+VKFSLL C Sbjct: 578 KLLKFVDTSQLCRGPQDSPGHWLVTGAKLDLEKGKICLRVKFSLLNIC 625 >CDP05572.1 unnamed protein product [Coffea canephora] Length = 596 Score = 82.4 bits (202), Expect = 8e-16 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD+S++CKGPQD PGHWLVTGAKLD++KGKI L VKFSLL C Sbjct: 548 KLLKFVDTSQLCKGPQDNPGHWLVTGAKLDLEKGKICLHVKFSLLNLC 595 >XP_006448143.1 hypothetical protein CICLE_v10014601mg [Citrus clementina] ESR61383.1 hypothetical protein CICLE_v10014601mg [Citrus clementina] Length = 626 Score = 82.0 bits (201), Expect = 1e-15 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD+S++C GPQD+PGHWLVTGAKLD++KGKI L+VKFSLL C Sbjct: 578 KLLKFVDTSQLCSGPQDSPGHWLVTGAKLDLEKGKICLRVKFSLLNIC 625 >XP_012072333.1 PREDICTED: MACPF domain-containing protein At1g14780 [Jatropha curcas] KDP38138.1 hypothetical protein JCGZ_04781 [Jatropha curcas] Length = 593 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD S++C+GPQD+PGHWL TGAKLD++KGKI LQVKFSLL C Sbjct: 545 KLLKFVDISQLCRGPQDSPGHWLATGAKLDLEKGKICLQVKFSLLNIC 592 >OAY29323.1 hypothetical protein MANES_15G136000 [Manihot esculenta] Length = 594 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD S++CKGPQD+PGHWLVTGAKL++++GKI LQVKFSLL C Sbjct: 546 KLLKFVDLSQLCKGPQDSPGHWLVTGAKLELERGKICLQVKFSLLNIC 593 >XP_002312471.2 hypothetical protein POPTR_0008s13580g [Populus trichocarpa] EEE89838.2 hypothetical protein POPTR_0008s13580g [Populus trichocarpa] Length = 594 Score = 81.6 bits (200), Expect = 1e-15 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 KLL +VD S +C+GPQD+PGHWLVTGA+LD+DKGKISLQVKFSLL Sbjct: 548 KLLKFVDISHLCRGPQDSPGHWLVTGARLDLDKGKISLQVKFSLL 592 >EEF29192.1 conserved hypothetical protein [Ricinus communis] Length = 281 Score = 79.7 bits (195), Expect = 2e-15 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD S++C+GPQ++PGHWLVTGAKLD+++GKI LQVKFSLL C Sbjct: 232 KLLKFVDISQLCRGPQNSPGHWLVTGAKLDMERGKICLQVKFSLLNIC 279 >XP_006849790.1 PREDICTED: MACPF domain-containing protein At1g14780 [Amborella trichopoda] ERN11371.1 hypothetical protein AMTR_s00176p00035220 [Amborella trichopoda] Length = 520 Score = 80.9 bits (198), Expect = 3e-15 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQY 142 KLL +VD+S VCKGP+D+PGHWLVTGAKLD+DKGKI L VKFSLL + Sbjct: 467 KLLRFVDASHVCKGPRDSPGHWLVTGAKLDMDKGKICLHVKFSLLDW 513 >XP_019176523.1 PREDICTED: MACPF domain-containing protein At1g14780 [Ipomoea nil] Length = 605 Score = 80.9 bits (198), Expect = 3e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD+S +CKGP D+PGHWLVTGAKLD+D+GKI L VKFSLL C Sbjct: 557 KLLKFVDTSHLCKGPSDSPGHWLVTGAKLDMDRGKICLHVKFSLLNIC 604 >KCW63934.1 hypothetical protein EUGRSUZ_G01611 [Eucalyptus grandis] Length = 217 Score = 77.8 bits (190), Expect = 4e-15 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 KLL +VD+S+ CKGPQD+PGHWLVTGAKLD++KGKI + VKFSLL Sbjct: 167 KLLKFVDTSQRCKGPQDSPGHWLVTGAKLDLEKGKICVHVKFSLL 211 >XP_011024349.1 PREDICTED: MACPF domain-containing protein At1g14780-like isoform X2 [Populus euphratica] XP_011024359.1 PREDICTED: MACPF domain-containing protein At1g14780-like isoform X2 [Populus euphratica] Length = 516 Score = 80.1 bits (196), Expect = 5e-15 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 K L +VD S +C+GPQD+PGHWLVTGA+LD+DKGKISLQVKFSLL Sbjct: 468 KFLKFVDISHLCRGPQDSPGHWLVTGARLDLDKGKISLQVKFSLL 512 >XP_018837919.1 PREDICTED: MACPF domain-containing protein At1g14780 [Juglans regia] Length = 593 Score = 80.1 bits (196), Expect = 5e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD SE+CKGP D+PGHWLVTGA+LD++KGKI L VKFSLL C Sbjct: 546 KLLKFVDMSELCKGPLDSPGHWLVTGARLDLEKGKICLNVKFSLLNIC 593 >XP_011024339.1 PREDICTED: MACPF domain-containing protein At1g14780-like isoform X1 [Populus euphratica] Length = 596 Score = 80.1 bits (196), Expect = 5e-15 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLL 136 K L +VD S +C+GPQD+PGHWLVTGA+LD+DKGKISLQVKFSLL Sbjct: 548 KFLKFVDISHLCRGPQDSPGHWLVTGARLDLDKGKISLQVKFSLL 592 >XP_002533200.2 PREDICTED: MACPF domain-containing protein At1g14780 [Ricinus communis] Length = 527 Score = 79.7 bits (195), Expect = 7e-15 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +2 Query: 2 KLLSYVDSSEVCKGPQDAPGHWLVTGAKLDIDKGKISLQVKFSLLQYC 145 KLL +VD S++C+GPQ++PGHWLVTGAKLD+++GKI LQVKFSLL C Sbjct: 478 KLLKFVDISQLCRGPQNSPGHWLVTGAKLDMERGKICLQVKFSLLNIC 525