BLASTX nr result
ID: Ephedra29_contig00021459
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00021459 (595 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR17081.1 unknown [Picea sitchensis] 85 7e-18 KZV37868.1 hypothetical protein F511_31211 [Dorcoceras hygrometr... 57 2e-07 XP_012831825.1 PREDICTED: uncharacterized protein LOC105952794 [... 53 5e-06 XP_002534277.1 PREDICTED: uncharacterized protein LOC8261800 [Ri... 53 8e-06 KZN03372.1 hypothetical protein DCAR_012128 [Daucus carota subsp... 52 9e-06 >ABR17081.1 unknown [Picea sitchensis] Length = 127 Score = 85.1 bits (209), Expect = 7e-18 Identities = 50/78 (64%), Positives = 56/78 (71%), Gaps = 7/78 (8%) Frame = +2 Query: 245 MEGLLPMVYRAIVQYKSGGQRIYGAFASSSPGDSGRLAWENAYMRLPGNDSGRLTSEFVE 424 MEGLLP VYRAIVQY+ QR+YGA AS PGDSGR +WE+AY+RLPG DSGR SE E Sbjct: 1 MEGLLPYVYRAIVQYRCS-QRLYGALAS--PGDSGRFSWESAYIRLPG-DSGRFASEIHE 56 Query: 425 -------SAQNIYRRSIS 457 S+Q IYRRS S Sbjct: 57 FIVEALPSSQTIYRRSAS 74 >KZV37868.1 hypothetical protein F511_31211 [Dorcoceras hygrometricum] Length = 88 Score = 56.6 bits (135), Expect = 2e-07 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 245 MEGLLPMVYRAIVQYKSGGQRIYGAFASSSPGDSGRLAWENAYMRLPGNDSGR-LTSE 415 MEGL+P VY+AIVQYKSGGQ + + + SP +AYMRLPG DSGR LTSE Sbjct: 1 MEGLIPFVYKAIVQYKSGGQGMIRTWLNESP--------SSAYMRLPG-DSGRFLTSE 49 >XP_012831825.1 PREDICTED: uncharacterized protein LOC105952794 [Erythranthe guttata] EYU41761.1 hypothetical protein MIMGU_mgv1a017291mg [Erythranthe guttata] Length = 83 Score = 52.8 bits (125), Expect = 5e-06 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = +2 Query: 245 MEGLLPMVYRAIVQYKSGGQRIYGAFASSSPGDSGRLAWENAYMRLPGNDSGRLTSEFVE 424 MEGL+P VY+AIVQYK+GG+ G + + SP S YMR+P DSGR ++ ++ Sbjct: 1 MEGLIPFVYKAIVQYKNGGR---GTWLNESPSAS--------YMRIPAGDSGRFSTSDIQ 49 Query: 425 SAQNIY 442 ++ Y Sbjct: 50 LSRPDY 55 >XP_002534277.1 PREDICTED: uncharacterized protein LOC8261800 [Ricinus communis] EEF28108.1 conserved hypothetical protein [Ricinus communis] Length = 106 Score = 52.8 bits (125), Expect = 8e-06 Identities = 29/86 (33%), Positives = 47/86 (54%) Frame = +2 Query: 245 MEGLLPMVYRAIVQYKSGGQRIYGAFASSSPGDSGRLAWENAYMRLPGNDSGRLTSEFVE 424 MEGL+P VYRAI+QYK+G + G++ + SP + YMRLP DSGR + + Sbjct: 1 MEGLIPFVYRAIMQYKNGNEGPLGSWLNESP--------SSCYMRLPTGDSGRFQASDIR 52 Query: 425 SAQNIYRRSISTNDRDHSKLKDSNPL 502 + Y S ++ + + + S+ + Sbjct: 53 LFGSDYGFSTTSTTTNTNTITSSSSI 78 >KZN03372.1 hypothetical protein DCAR_012128 [Daucus carota subsp. sativus] Length = 81 Score = 52.0 bits (123), Expect = 9e-06 Identities = 31/53 (58%), Positives = 35/53 (66%) Frame = +2 Query: 245 MEGLLPMVYRAIVQYKSGGQRIYGAFASSSPGDSGRLAWENAYMRLPGNDSGR 403 MEGL+P VYRAIVQY++GG G+F S SP AYMRLPG DSGR Sbjct: 1 MEGLIPFVYRAIVQYRNGGD--MGSFLSESP--------SAAYMRLPG-DSGR 42