BLASTX nr result
ID: Ephedra29_contig00020989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020989 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY74950.1 hypothetical protein ACMD2_00694 [Ananas comosus] 54 3e-06 >OAY74950.1 hypothetical protein ACMD2_00694 [Ananas comosus] Length = 453 Score = 53.5 bits (127), Expect = 3e-06 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 8/98 (8%) Frame = +2 Query: 5 YIEAHPKASILRGTRVRHFDKLQIIFGNDQAT--------DEFAIEGNDSVPQTPLEYID 160 YI+AHPKA+ + ++H+++L+II G+DQAT DEF E N+ V E D Sbjct: 247 YIKAHPKAADILNRPIKHYEELRIICGDDQATGYFKSSLFDEFG-ENNNEVFSLEYEKND 305 Query: 161 IDLDETVGNGEGECSHGNAPRTKGHTNTSSLPPKRRRS 274 I+ ++ V +G + R + SSL + R S Sbjct: 306 IEFEDEVDEIDGRFAQAEGARKAPNNGASSLSGRARSS 343