BLASTX nr result
ID: Ephedra29_contig00020837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020837 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE29989.1 hypothetical protein AXG93_669s1390 [Marchantia polym... 61 4e-09 >OAE29989.1 hypothetical protein AXG93_669s1390 [Marchantia polymorpha subsp. polymorpha] Length = 1108 Score = 60.8 bits (146), Expect = 4e-09 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = -3 Query: 193 SYVSLRSLATSLAARKRRIYEIFCVLECINVVQSFEGPEKFLWLGSKRVPSALRIIK 23 +YV+LR LA +L AR+RRI EI VLE INV+Q+ +G EK+LWLGS ++ AL +K Sbjct: 454 AYVTLRLLANTLGARRRRILEIINVLEIINVIQN-QGKEKYLWLGSTQIARALLRLK 509