BLASTX nr result
ID: Ephedra29_contig00020783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020783 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH12159.1 hypothetical protein GLYMA_15G155900 [Glycine max] 53 5e-06 XP_006597751.1 PREDICTED: DDB1- and CUL4-associated factor 4-lik... 53 5e-06 >KRH12159.1 hypothetical protein GLYMA_15G155900 [Glycine max] Length = 511 Score = 53.1 bits (126), Expect = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -2 Query: 261 MPTPKEIPGFYYDEERNRYFPVKKWAPGVPAQP 163 MP PKE+PGFYYD E+NRYFP+K PG ++P Sbjct: 1 MPQPKELPGFYYDPEKNRYFPIKGPIPGSSSKP 33 >XP_006597751.1 PREDICTED: DDB1- and CUL4-associated factor 4-like [Glycine max] KRH12160.1 hypothetical protein GLYMA_15G155900 [Glycine max] Length = 514 Score = 53.1 bits (126), Expect = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -2 Query: 261 MPTPKEIPGFYYDEERNRYFPVKKWAPGVPAQP 163 MP PKE+PGFYYD E+NRYFP+K PG ++P Sbjct: 1 MPQPKELPGFYYDPEKNRYFPIKGPIPGSSSKP 33