BLASTX nr result
ID: Ephedra29_contig00020534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020534 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002983674.1 hypothetical protein SELMODRAFT_234346 [Selaginel... 74 5e-13 XP_002990535.1 hypothetical protein SELMODRAFT_185313 [Selaginel... 74 5e-13 CBI34999.3 unnamed protein product, partial [Vitis vinifera] 73 6e-13 XP_002276011.1 PREDICTED: serine/threonine-protein kinase D6PK [... 73 6e-13 XP_002975063.1 hypothetical protein SELMODRAFT_150418 [Selaginel... 73 8e-13 XP_002974209.1 hypothetical protein SELMODRAFT_11420, partial [S... 73 8e-13 GAV85070.1 Pkinase domain-containing protein [Cephalotus follicu... 72 2e-12 OAE25425.1 hypothetical protein AXG93_2818s1020 [Marchantia poly... 72 2e-12 OMO79114.1 hypothetical protein CCACVL1_13905 [Corchorus capsula... 70 4e-12 XP_017621155.1 PREDICTED: serine/threonine-protein kinase D6PK [... 71 4e-12 XP_016727849.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 71 4e-12 XP_012460675.1 PREDICTED: serine/threonine-protein kinase D6PK [... 71 4e-12 ABR16313.1 unknown [Picea sitchensis] 71 4e-12 XP_016751451.1 PREDICTED: serine/threonine-protein kinase D6PK-l... 71 4e-12 XP_008341516.1 PREDICTED: serine/threonine-protein kinase D6PKL2... 70 8e-12 OMO52769.1 hypothetical protein COLO4_36983 [Corchorus olitorius] 70 8e-12 KDO72425.1 hypothetical protein CISIN_1g010603mg [Citrus sinensis] 70 1e-11 XP_006482514.1 PREDICTED: serine/threonine-protein kinase D6PKL2... 70 1e-11 XP_006431047.1 hypothetical protein CICLE_v10011523mg [Citrus cl... 70 1e-11 XP_004304958.1 PREDICTED: serine/threonine-protein kinase D6PK [... 70 1e-11 >XP_002983674.1 hypothetical protein SELMODRAFT_234346 [Selaginella moellendorffii] EFJ15170.1 hypothetical protein SELMODRAFT_234346 [Selaginella moellendorffii] Length = 514 Score = 73.6 bits (179), Expect = 5e-13 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA*NRK 283 R G GLSHF L LGCGDIG VYLA+LRS SC FA+KVM KGSL +RKK L A K Sbjct: 99 REGLLGLSHFRLLKRLGCGDIGSVYLAELRSTSCYFAMKVMDKGSLASRKKVLRAQTEK 157 >XP_002990535.1 hypothetical protein SELMODRAFT_185313 [Selaginella moellendorffii] EFJ08412.1 hypothetical protein SELMODRAFT_185313 [Selaginella moellendorffii] Length = 514 Score = 73.6 bits (179), Expect = 5e-13 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA*NRK 283 R G GLSHF L LGCGDIG VYLA+LRS SC FA+KVM KGSL +RKK L A K Sbjct: 99 REGLLGLSHFRLLKRLGCGDIGSVYLAELRSTSCYFAMKVMDKGSLASRKKVLRAQTEK 157 >CBI34999.3 unnamed protein product, partial [Vitis vinifera] Length = 497 Score = 73.2 bits (178), Expect = 6e-13 Identities = 35/53 (66%), Positives = 39/53 (73%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL HF L LGCGDIG VYLA+LR +SC FA+KVM KG LE RKK + A Sbjct: 138 GDMGLCHFRLLKKLGCGDIGSVYLAELRGMSCLFAMKVMDKGMLEERKKLMRA 190 >XP_002276011.1 PREDICTED: serine/threonine-protein kinase D6PK [Vitis vinifera] Length = 538 Score = 73.2 bits (178), Expect = 6e-13 Identities = 35/53 (66%), Positives = 39/53 (73%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL HF L LGCGDIG VYLA+LR +SC FA+KVM KG LE RKK + A Sbjct: 138 GDMGLCHFRLLKKLGCGDIGSVYLAELRGMSCLFAMKVMDKGMLEERKKLMRA 190 >XP_002975063.1 hypothetical protein SELMODRAFT_150418 [Selaginella moellendorffii] EFJ23848.1 hypothetical protein SELMODRAFT_150418 [Selaginella moellendorffii] Length = 402 Score = 72.8 bits (177), Expect = 8e-13 Identities = 38/59 (64%), Positives = 41/59 (69%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA*NRK 283 R G GLSHF L LGCGDIG VYLA+LRS SC FA+KVM K SL +RKK L A K Sbjct: 2 RDGSLGLSHFRLLKRLGCGDIGSVYLAELRSTSCHFAMKVMDKASLASRKKLLRAQTEK 60 >XP_002974209.1 hypothetical protein SELMODRAFT_11420, partial [Selaginella moellendorffii] EFJ24431.1 hypothetical protein SELMODRAFT_11420, partial [Selaginella moellendorffii] Length = 411 Score = 72.8 bits (177), Expect = 8e-13 Identities = 38/59 (64%), Positives = 41/59 (69%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA*NRK 283 R G GLSHF L LGCGDIG VYLA+LRS SC FA+KVM K SL +RKK L A K Sbjct: 49 RDGSLGLSHFRLLKRLGCGDIGSVYLAELRSTSCHFAMKVMDKASLASRKKLLRAQTEK 107 >GAV85070.1 Pkinase domain-containing protein [Cephalotus follicularis] Length = 497 Score = 71.6 bits (174), Expect = 2e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK L A Sbjct: 96 GDLGLAHFRLLKKLGCGDIGSVYLAELRGVGCLFAMKVMDKGMLAGRKKLLRA 148 >OAE25425.1 hypothetical protein AXG93_2818s1020 [Marchantia polymorpha subsp. polymorpha] Length = 604 Score = 71.6 bits (174), Expect = 2e-12 Identities = 36/55 (65%), Positives = 41/55 (74%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 R G GLSHF L LGCGDIG VYLA+LR+ +C FA+KVM KGSL +RKK L A Sbjct: 145 RDGAMGLSHFKLLKRLGCGDIGSVYLAELRASNCYFAMKVMDKGSLASRKKLLRA 199 >OMO79114.1 hypothetical protein CCACVL1_13905 [Corchorus capsularis] Length = 271 Score = 70.1 bits (170), Expect = 4e-12 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK + A Sbjct: 131 GDLGLAHFRLLKKLGCGDIGSVYLAELRGMGCLFAMKVMDKGMLAGRKKLMRA 183 >XP_017621155.1 PREDICTED: serine/threonine-protein kinase D6PK [Gossypium arboreum] Length = 523 Score = 70.9 bits (172), Expect = 4e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK L A Sbjct: 123 GDLGLAHFRLLKKLGCGDIGSVYLAELRGMGCLFAMKVMDKGMLAGRKKLLRA 175 >XP_016727849.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Gossypium hirsutum] Length = 523 Score = 70.9 bits (172), Expect = 4e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK L A Sbjct: 123 GDLGLAHFRLLKKLGCGDIGSVYLAELRGMGCLFAMKVMDKGMLAGRKKLLRA 175 >XP_012460675.1 PREDICTED: serine/threonine-protein kinase D6PK [Gossypium raimondii] KJB75781.1 hypothetical protein B456_012G057700 [Gossypium raimondii] Length = 523 Score = 70.9 bits (172), Expect = 4e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK L A Sbjct: 123 GDLGLAHFRLLKKLGCGDIGSVYLAELRGMGCLFAMKVMDKGMLAGRKKLLRA 175 >ABR16313.1 unknown [Picea sitchensis] Length = 545 Score = 70.9 bits (172), Expect = 4e-12 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 R G GLSHF L +G GDIG VYLA+LR +C FA+KVM KGSLENR KSL A Sbjct: 147 RDGFLGLSHFRLLKRVGSGDIGSVYLAELRGTNCFFAMKVMDKGSLENRNKSLRA 201 >XP_016751451.1 PREDICTED: serine/threonine-protein kinase D6PK-like [Gossypium hirsutum] Length = 649 Score = 70.9 bits (172), Expect = 4e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK L A Sbjct: 249 GDLGLAHFRLLKKLGCGDIGSVYLAELRGMGCLFAMKVMDKGMLAGRKKLLRA 301 >XP_008341516.1 PREDICTED: serine/threonine-protein kinase D6PKL2 [Malus domestica] Length = 515 Score = 70.1 bits (170), Expect = 8e-12 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = +2 Query: 107 RCGDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 R GD GL HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK + A Sbjct: 113 RDGDLGLGHFRLLKKLGCGDIGSVYLAELRGMGCFFAMKVMDKGMLAGRKKLIRA 167 >OMO52769.1 hypothetical protein COLO4_36983 [Corchorus olitorius] Length = 538 Score = 70.1 bits (170), Expect = 8e-12 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL+HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK + A Sbjct: 131 GDLGLAHFRLLKKLGCGDIGSVYLAELRGMGCLFAMKVMDKGMLAGRKKLMRA 183 >KDO72425.1 hypothetical protein CISIN_1g010603mg [Citrus sinensis] Length = 506 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK + A Sbjct: 106 GDLGLGHFRLLKKLGCGDIGSVYLAELRDMGCLFAMKVMDKGMLAGRKKLMRA 158 >XP_006482514.1 PREDICTED: serine/threonine-protein kinase D6PKL2 [Citrus sinensis] Length = 506 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK + A Sbjct: 106 GDLGLGHFRLLKKLGCGDIGSVYLAELRDMGCLFAMKVMDKGMLAGRKKLMRA 158 >XP_006431047.1 hypothetical protein CICLE_v10011523mg [Citrus clementina] ESR44287.1 hypothetical protein CICLE_v10011523mg [Citrus clementina] Length = 506 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 GD GL HF L LGCGDIG VYLA+LR + C FA+KVM KG L RKK + A Sbjct: 106 GDLGLGHFRLLKKLGCGDIGSVYLAELRDMGCLFAMKVMDKGMLAGRKKLMRA 158 >XP_004304958.1 PREDICTED: serine/threonine-protein kinase D6PK [Fragaria vesca subsp. vesca] Length = 512 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +2 Query: 113 GDFGLSHFCLFNHLGCGDIGIVYLADLRSISCCFAIKVMGKGSLENRKKSLMA 271 G+ GL+HF L LGCGDIG VYLA+LR I C FA+KVM KG L RKK + A Sbjct: 110 GELGLNHFRLLKKLGCGDIGSVYLAELRGIGCVFAMKVMDKGMLAGRKKLMRA 162