BLASTX nr result
ID: Ephedra29_contig00020473
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020473 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAQ84048.1 hypothetical protein KFL_001740070 [Klebsormidium fla... 55 6e-06 >GAQ84048.1 hypothetical protein KFL_001740070 [Klebsormidium flaccidum] Length = 986 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +3 Query: 72 QSKPYWFVDGSKKVYVNKFGETLTGRAAYISHLKESGKQ 188 Q K +W G KKVYVNK G+TL GRAAY SHLK+SG Q Sbjct: 931 QEKGHWTTIGGKKVYVNKTGKTLEGRAAYRSHLKDSGAQ 969