BLASTX nr result
ID: Ephedra29_contig00020240
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020240 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47424.1 hypothetical protein TSUD_46360 [Trifolium subterraneum] 91 9e-22 GAU21145.1 hypothetical protein TSUD_10620 [Trifolium subterraneum] 90 1e-21 JAU58946.1 Pentatricopeptide repeat-containing protein, partial ... 87 1e-20 CBI18780.3 unnamed protein product, partial [Vitis vinifera] 92 1e-20 CAA06832.1 DYW10 protein, partial [Arabidopsis thaliana] 87 2e-20 KDO45404.1 hypothetical protein CISIN_1g0074161mg, partial [Citr... 87 2e-20 XP_002302824.2 hypothetical protein POPTR_0002s22590g [Populus t... 92 4e-20 XP_011003599.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 4e-20 CBI22024.3 unnamed protein product, partial [Vitis vinifera] 86 4e-20 AFG48749.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 86 5e-20 AFG48740.1 hypothetical protein 0_2087_01, partial [Pinus taeda]... 86 5e-20 AFG48739.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 86 5e-20 AEW07459.1 hypothetical protein 0_2087_01, partial [Pinus radiata] 86 5e-20 AFG48743.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 85 6e-20 XP_010647024.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 8e-20 JAU09193.1 Pentatricopeptide repeat-containing protein, partial ... 87 9e-20 XP_013469834.1 PPR containing plant-like protein [Medicago trunc... 91 1e-19 XP_004496720.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 1e-19 XP_003617141.1 pentatricopeptide (PPR) repeat protein [Medicago ... 91 1e-19 EMT26564.1 hypothetical protein F775_03208 [Aegilops tauschii] 86 1e-19 >GAU47424.1 hypothetical protein TSUD_46360 [Trifolium subterraneum] Length = 144 Score = 91.3 bits (225), Expect = 9e-22 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KN+R+CGDCH AIKFIS++ REI+VRD HRFHRFKDG CSC+DYW Sbjct: 97 ITKNLRICGDCHSAIKFISRIVGREIIVRDNHRFHRFKDGCCSCKDYW 144 >GAU21145.1 hypothetical protein TSUD_10620 [Trifolium subterraneum] Length = 105 Score = 89.7 bits (221), Expect = 1e-21 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 IMKNIRVCGDCH AIK++S V REI+VRDT+RFH F+DG+CSCRDYW Sbjct: 58 IMKNIRVCGDCHSAIKYVSLVVKREIIVRDTNRFHHFRDGSCSCRDYW 105 >JAU58946.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 98 Score = 87.0 bits (214), Expect = 1e-20 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 +MKN+RVC DCH IKF+SKVSNREI+VRD +RFH F++G+CSC+DYW Sbjct: 51 VMKNLRVCNDCHDWIKFVSKVSNREIIVRDAYRFHHFEEGSCSCKDYW 98 >CBI18780.3 unnamed protein product, partial [Vitis vinifera] Length = 289 Score = 91.7 bits (226), Expect = 1e-20 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KNIRVCGDCH AIKF+SKV +REI+VRDT+RFHRF+DG+CSC DYW Sbjct: 242 IKKNIRVCGDCHAAIKFVSKVVDREIIVRDTNRFHRFRDGSCSCGDYW 289 >CAA06832.1 DYW10 protein, partial [Arabidopsis thaliana] Length = 105 Score = 86.7 bits (213), Expect = 2e-20 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 + KN+R+CGDCH AIKFIS++ REI+VRDT RFH FKDG+CSC DYW Sbjct: 58 VFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDGSCSCGDYW 105 >KDO45404.1 hypothetical protein CISIN_1g0074161mg, partial [Citrus sinensis] Length = 109 Score = 86.7 bits (213), Expect = 2e-20 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 IMKN+RVCGDCH AIKF+SK S R I+VRD +RFHRF+DG CSC DYW Sbjct: 62 IMKNLRVCGDCHTAIKFMSKCSGRVIIVRDNNRFHRFEDGKCSCGDYW 109 >XP_002302824.2 hypothetical protein POPTR_0002s22590g [Populus trichocarpa] EEE82097.2 hypothetical protein POPTR_0002s22590g [Populus trichocarpa] Length = 647 Score = 92.4 bits (228), Expect = 4e-20 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KN+RVCGDCH A KFISKV+ REIVVRD HRFH FK+GACSCRDYW Sbjct: 600 IRKNLRVCGDCHTATKFISKVTGREIVVRDAHRFHHFKNGACSCRDYW 647 >XP_011003599.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Populus euphratica] Length = 697 Score = 92.4 bits (228), Expect = 4e-20 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KN+RVCGDCH A KFISKV+ REIVVRD HRFH FK+GACSCRDYW Sbjct: 650 IRKNLRVCGDCHTATKFISKVTGREIVVRDAHRFHHFKNGACSCRDYW 697 >CBI22024.3 unnamed protein product, partial [Vitis vinifera] Length = 119 Score = 86.3 bits (212), Expect = 4e-20 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 ++KN+RVC DCHVAIK+IS++SNREI+VRD+ RFH FK+G CSC DYW Sbjct: 72 VIKNLRVCSDCHVAIKYISEISNREIIVRDSSRFHHFKNGRCSCGDYW 119 >AFG48749.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 85.5 bits (210), Expect = 5e-20 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 ++KN+RVCGDCH IKFISKV REI++RDT RFH FKDG CSCR++W Sbjct: 48 VLKNLRVCGDCHSVIKFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AFG48740.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48741.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48742.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48744.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48745.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48746.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48747.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48748.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48750.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48751.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48753.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 85.5 bits (210), Expect = 5e-20 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 ++KN+RVCGDCH IKFISKV REI++RDT RFH FKDG CSCR++W Sbjct: 48 VLKNLRVCGDCHSVIKFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AFG48739.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 85.5 bits (210), Expect = 5e-20 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 ++KN+RVCGDCH IKFISKV REI++RDT RFH FKDG CSCR++W Sbjct: 48 VLKNLRVCGDCHSVIKFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AEW07459.1 hypothetical protein 0_2087_01, partial [Pinus radiata] Length = 95 Score = 85.5 bits (210), Expect = 5e-20 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 ++KN+RVCGDCH IKFISKV REI++RDT RFH FKDG CSCR++W Sbjct: 48 VLKNLRVCGDCHSVIKFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AFG48743.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 85.1 bits (209), Expect = 6e-20 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 ++KN+RVCGDCH IKFISKV REI++RDT RFH FKDG CSCR++W Sbjct: 48 VVKNLRVCGDCHSVIKFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >XP_010647024.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Vitis vinifera] Length = 663 Score = 91.7 bits (226), Expect = 8e-20 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KNIRVCGDCH AIKF+SKV +REI+VRDT+RFHRF+DG+CSC DYW Sbjct: 616 IKKNIRVCGDCHAAIKFVSKVVDREIIVRDTNRFHRFRDGSCSCGDYW 663 >JAU09193.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 178 Score = 87.0 bits (214), Expect = 9e-20 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 +MKN+RVC DCH IKF+SKVSNREI+VRD +RFH F++G+CSC+DYW Sbjct: 131 VMKNLRVCNDCHDWIKFVSKVSNREIIVRDAYRFHHFQEGSCSCKDYW 178 >XP_013469834.1 PPR containing plant-like protein [Medicago truncatula] KEH43872.1 PPR containing plant-like protein [Medicago truncatula] Length = 684 Score = 91.3 bits (225), Expect = 1e-19 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KN+R+CGDCH AIKFIS++ REI+VRD HRFHRFKDG CSC+DYW Sbjct: 637 ITKNLRICGDCHSAIKFISRIVGREIIVRDNHRFHRFKDGCCSCKDYW 684 >XP_004496720.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14850 [Cicer arietinum] Length = 684 Score = 91.3 bits (225), Expect = 1e-19 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KN+R+CGDCH AIKFIS++ REI+VRD HRFHRFKDG CSC+DYW Sbjct: 637 ITKNLRICGDCHSAIKFISRIVGREIIVRDNHRFHRFKDGCCSCKDYW 684 >XP_003617141.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AET00100.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 684 Score = 91.3 bits (225), Expect = 1e-19 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 I KN+R+CGDCH AIKFIS++ REI+VRD HRFHRFKDG CSC+DYW Sbjct: 637 ITKNLRICGDCHSAIKFISRIVGREIIVRDNHRFHRFKDGCCSCKDYW 684 >EMT26564.1 hypothetical protein F775_03208 [Aegilops tauschii] Length = 128 Score = 85.5 bits (210), Expect = 1e-19 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 243 IMKNIRVCGDCHVAIKFISKVSNREIVVRDTHRFHRFKDGACSCRDYW 100 IMKNIR+CGDCH A K++SKV REIVVRDT+RFH F +G+CSC DYW Sbjct: 81 IMKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSNGSCSCGDYW 128