BLASTX nr result
ID: Ephedra29_contig00020166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00020166 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010231695.1 PREDICTED: double-stranded RNA-binding protein 2-... 77 6e-15 XP_019052346.1 PREDICTED: double-stranded RNA-binding protein 5-... 77 1e-14 XP_010250596.1 PREDICTED: double-stranded RNA-binding protein 3-... 77 1e-14 BAS92299.1 Os05g0150400, partial [Oryza sativa Japonica Group] 77 1e-14 EEE62351.1 hypothetical protein OsJ_17140 [Oryza sativa Japonica... 77 1e-14 XP_001776641.1 double-stranded RNA binding protein [Physcomitrel... 77 1e-14 KNA17177.1 hypothetical protein SOVF_082520, partial [Spinacia o... 73 2e-14 XP_010091718.1 Double-stranded RNA-binding protein 2 [Morus nota... 76 2e-14 XP_018834902.1 PREDICTED: double-stranded RNA-binding protein 3-... 75 3e-14 EMS63735.1 Double-stranded RNA-binding protein 2 [Triticum urartu] 75 3e-14 KZN05601.1 hypothetical protein DCAR_006438 [Daucus carota subsp... 70 3e-14 CDO99741.1 unnamed protein product [Coffea canephora] 71 3e-14 ERN06252.1 hypothetical protein AMTR_s00016p00199170 [Amborella ... 75 4e-14 XP_008388626.1 PREDICTED: double-stranded RNA-binding protein 3-... 75 5e-14 XP_016481606.1 PREDICTED: double-stranded RNA-binding protein 2-... 71 7e-14 OAE32316.1 hypothetical protein AXG93_3103s1030 [Marchantia poly... 74 1e-13 XP_012492929.1 PREDICTED: double-stranded RNA-binding protein 2-... 74 1e-13 EMT33749.1 Ribonuclease 3 [Aegilops tauschii] 74 1e-13 XP_015893767.1 PREDICTED: LOW QUALITY PROTEIN: double-stranded R... 73 1e-13 KCW51388.1 hypothetical protein EUGRSUZ_J00927, partial [Eucalyp... 73 1e-13 >XP_010231695.1 PREDICTED: double-stranded RNA-binding protein 2-like [Brachypodium distachyon] Length = 742 Score = 77.4 bits (189), Expect = 6e-15 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 116 QIFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 ++ AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 179 EVDAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 215 >XP_019052346.1 PREDICTED: double-stranded RNA-binding protein 5-like isoform X1 [Nelumbo nucifera] Length = 484 Score = 76.6 bits (187), Expect = 1e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 125 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 2 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 35 >XP_010250596.1 PREDICTED: double-stranded RNA-binding protein 3-like [Nelumbo nucifera] Length = 495 Score = 76.6 bits (187), Expect = 1e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 125 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 23 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 56 >BAS92299.1 Os05g0150400, partial [Oryza sativa Japonica Group] Length = 603 Score = 76.6 bits (187), Expect = 1e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 125 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 9 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 42 >EEE62351.1 hypothetical protein OsJ_17140 [Oryza sativa Japonica Group] Length = 606 Score = 76.6 bits (187), Expect = 1e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 125 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 12 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 45 >XP_001776641.1 double-stranded RNA binding protein [Physcomitrella patens] EDQ58477.1 double-stranded RNA binding protein [Physcomitrella patens] Length = 1053 Score = 76.6 bits (187), Expect = 1e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 116 QIFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 ++ AGMYKNQLQELAQRSCFNLP+YACIREGPDHAPR Sbjct: 225 RVVAGMYKNQLQELAQRSCFNLPAYACIREGPDHAPR 261 >KNA17177.1 hypothetical protein SOVF_082520, partial [Spinacia oleracea] Length = 155 Score = 72.8 bits (177), Expect = 2e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 131 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 1 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 32 >XP_010091718.1 Double-stranded RNA-binding protein 2 [Morus notabilis] EXB45022.1 Double-stranded RNA-binding protein 2 [Morus notabilis] Length = 677 Score = 75.9 bits (185), Expect = 2e-14 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 113 FQIFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 F + +GMYKNQLQELAQRSCFNLPSY+CIREGPDHAPR Sbjct: 124 FVVDSGMYKNQLQELAQRSCFNLPSYSCIREGPDHAPR 161 >XP_018834902.1 PREDICTED: double-stranded RNA-binding protein 3-like isoform X1 [Juglans regia] Length = 495 Score = 75.5 bits (184), Expect = 3e-14 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 101 FGVHFQIFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 F V + A MYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 9 FVVDWFFMADMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 50 >EMS63735.1 Double-stranded RNA-binding protein 2 [Triticum urartu] Length = 714 Score = 75.5 bits (184), Expect = 3e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 116 QIFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 ++ AGM+KNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 139 KVDAGMFKNQLQELAQRSCFNLPSYACIREGPDHAPR 175 >KZN05601.1 hypothetical protein DCAR_006438 [Daucus carota subsp. sativus] Length = 83 Score = 70.1 bits (170), Expect = 3e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 131 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 MYKNQLQELAQRSCFNLP+Y CIREGPDHAPR Sbjct: 1 MYKNQLQELAQRSCFNLPAYTCIREGPDHAPR 32 >CDO99741.1 unnamed protein product [Coffea canephora] Length = 128 Score = 71.2 bits (173), Expect = 3e-14 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 131 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 MYKNQLQELAQRSCFNLPSY CIREGPDHAPR Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAPR 32 >ERN06252.1 hypothetical protein AMTR_s00016p00199170 [Amborella trichopoda] Length = 533 Score = 75.1 bits (183), Expect = 4e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 128 GMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 GMYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 32 GMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 64 >XP_008388626.1 PREDICTED: double-stranded RNA-binding protein 3-like isoform X1 [Malus domestica] Length = 583 Score = 74.7 bits (182), Expect = 5e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 119 IFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 + GMYKNQLQELAQRSCFNLPSY+CIREGPDHAPR Sbjct: 32 VLRGMYKNQLQELAQRSCFNLPSYSCIREGPDHAPR 67 >XP_016481606.1 PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tabacum] Length = 157 Score = 71.2 bits (173), Expect = 7e-14 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 131 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 MYKNQLQELAQRSCFNLPSY CIREGPDHAPR Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAPR 32 >OAE32316.1 hypothetical protein AXG93_3103s1030 [Marchantia polymorpha subsp. polymorpha] Length = 490 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 128 GMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 GMYKNQLQELAQRSCFNLP+YACIREGPDHAPR Sbjct: 15 GMYKNQLQELAQRSCFNLPAYACIREGPDHAPR 47 >XP_012492929.1 PREDICTED: double-stranded RNA-binding protein 2-like isoform X1 [Gossypium raimondii] Length = 533 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 119 IFAGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 +F MYKNQLQELAQRSCFNLPSY+CIREGPDHAPR Sbjct: 1 MFVDMYKNQLQELAQRSCFNLPSYSCIREGPDHAPR 36 >EMT33749.1 Ribonuclease 3 [Aegilops tauschii] Length = 691 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 125 AGMYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 +GM+KNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 88 SGMFKNQLQELAQRSCFNLPSYACIREGPDHAPR 121 >XP_015893767.1 PREDICTED: LOW QUALITY PROTEIN: double-stranded RNA-binding protein 2-like, partial [Ziziphus jujuba] Length = 297 Score = 72.8 bits (177), Expect = 1e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 131 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 1 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 32 >KCW51388.1 hypothetical protein EUGRSUZ_J00927, partial [Eucalyptus grandis] Length = 302 Score = 72.8 bits (177), Expect = 1e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 131 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 226 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR Sbjct: 92 MYKNQLQELAQRSCFNLPSYACIREGPDHAPR 123