BLASTX nr result
ID: Ephedra29_contig00019670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019670 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAR25142.1 annexin [Triticum aestivum] 52 1e-05 >AAR25142.1 annexin [Triticum aestivum] Length = 316 Score = 52.4 bits (124), Expect = 1e-05 Identities = 26/61 (42%), Positives = 37/61 (60%) Frame = +1 Query: 7 AVRGMLHDNGAVARVFVTRTDVDLKMIAEVYARKYKVGMVEMIQKEVSGHLKEFCLAIAQ 186 A++G+ N A+ RV VTRT+VD+K I Y KYK + E I E SG+ + F L++ Sbjct: 254 AMKGLGTSNAALTRVAVTRTEVDMKYIKAEYHNKYKGSLAEAIHSETSGNYRTFLLSLVG 313 Query: 187 R 189 R Sbjct: 314 R 314