BLASTX nr result
ID: Ephedra29_contig00019419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019419 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFB33800.1 hypothetical protein CL1052Contig1_03, partial [Abies... 57 2e-08 AEW08652.1 hypothetical protein CL1052Contig1_03, partial [Pinus... 56 3e-08 AFB33803.1 hypothetical protein CL1052Contig1_03, partial [Pinus... 56 4e-08 XP_019154967.1 PREDICTED: putative nitric oxide synthase [Ipomoe... 59 1e-07 GAV68104.1 MMR_HSR1 domain-containing protein [Cephalotus follic... 59 1e-07 ABR16951.1 unknown [Picea sitchensis] 59 1e-07 AFG49210.1 hypothetical protein CL1052Contig1_03, partial [Pinus... 54 2e-07 AFG49200.1 hypothetical protein CL1052Contig1_03, partial [Pinus... 54 2e-07 AFG49196.1 hypothetical protein CL1052Contig1_03, partial [Pinus... 54 2e-07 XP_018676996.1 PREDICTED: putative nitric oxide synthase isoform... 58 2e-07 AIJ27455.1 nitric oxide-associated protein [Elaeis guineensis] 58 2e-07 XP_009386346.1 PREDICTED: putative nitric oxide synthase isoform... 58 2e-07 XP_018676995.1 PREDICTED: putative nitric oxide synthase isoform... 58 2e-07 XP_018676994.1 PREDICTED: putative nitric oxide synthase isoform... 58 2e-07 XP_018676993.1 PREDICTED: putative nitric oxide synthase isoform... 58 2e-07 XP_017699183.1 PREDICTED: putative nitric oxide synthase [Phoeni... 57 3e-07 XP_016721149.1 PREDICTED: NO-associated protein 1, chloroplastic... 57 5e-07 XP_017634396.1 PREDICTED: NO-associated protein 1, chloroplastic... 57 5e-07 XP_017634395.1 PREDICTED: NO-associated protein 1, chloroplastic... 57 5e-07 XP_016721148.1 PREDICTED: NO-associated protein 1, chloroplastic... 57 5e-07 >AFB33800.1 hypothetical protein CL1052Contig1_03, partial [Abies alba] AFB33801.1 hypothetical protein CL1052Contig1_03, partial [Abies alba] AFB33802.1 hypothetical protein CL1052Contig1_03, partial [Abies alba] Length = 69 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWY 236 D+QL LL HV KPVEIFVRPP+PIG+ GS WY Sbjct: 28 DKQLHLLVHVAKPVEIFVRPPMPIGRLGSTWY 59 >AEW08652.1 hypothetical protein CL1052Contig1_03, partial [Pinus lambertiana] Length = 69 Score = 56.2 bits (134), Expect = 3e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWY 236 D+QL LL HV KPVE+FVRPP+PIG+ GS WY Sbjct: 28 DKQLHLLVHVAKPVEVFVRPPMPIGRLGSTWY 59 >AFB33803.1 hypothetical protein CL1052Contig1_03, partial [Pinus mugo] AFB33804.1 hypothetical protein CL1052Contig1_03, partial [Pinus mugo] Length = 69 Score = 55.8 bits (133), Expect = 4e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWY 236 D+QL LL HV KPVE+FVRPP+P+G+ GS WY Sbjct: 28 DKQLHLLVHVAKPVEVFVRPPMPVGRLGSTWY 59 >XP_019154967.1 PREDICTED: putative nitric oxide synthase [Ipomoea nil] Length = 554 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -3 Query: 325 QLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +LDL+ HVPKPVEIFVRPP+P+GK G+ WY E RPK ++ Sbjct: 507 ELDLVVHVPKPVEIFVRPPMPVGKAGAEWYDYRELTETEEEVRPKWYF 554 >GAV68104.1 MMR_HSR1 domain-containing protein [Cephalotus follicularis] Length = 567 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = -3 Query: 349 ITSLSDDRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPK 191 I S D++L L HVPKPVEIFVRPP+P+GK G+ WY E RPK Sbjct: 512 INSEETDKELHLAVHVPKPVEIFVRPPMPVGKGGAKWYQYRELTENEEEVRPK 564 >ABR16951.1 unknown [Picea sitchensis] Length = 601 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 D+QL LL HV KPVE+FVR P+PIG+ GS WY E RPK+ Y Sbjct: 552 DKQLHLLVHVAKPVEVFVRAPMPIGRLGSTWYEYSELTEEEEETRPKVSY 601 >AFG49210.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] Length = 69 Score = 54.3 bits (129), Expect = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWY 236 D++L LL HV KPVE+FVRPP+P+G+ GS WY Sbjct: 28 DKRLHLLVHVAKPVEVFVRPPMPVGRLGSTWY 59 >AFG49200.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49201.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] Length = 69 Score = 54.3 bits (129), Expect = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWY 236 D++L LL HV KPVE+FVRPP+P+G+ GS WY Sbjct: 28 DKRLHLLVHVAKPVEVFVRPPMPVGRLGSTWY 59 >AFG49196.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49197.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49199.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49202.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49203.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49204.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49206.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] AFG49209.1 hypothetical protein CL1052Contig1_03, partial [Pinus taeda] Length = 69 Score = 54.3 bits (129), Expect = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 331 DRQLDLLFHVPKPVEIFVRPPVPIGKFGSLWY 236 D++L LL HV KPVE+FVRPP+P+G+ GS WY Sbjct: 28 DKRLHLLVHVAKPVEVFVRPPMPVGRLGSTWY 59 >XP_018676996.1 PREDICTED: putative nitric oxide synthase isoform X5 [Musa acuminata subsp. malaccensis] Length = 424 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 325 QLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +L L HVPKPVEIF+RPP+P+GK G WY E+RPK FY Sbjct: 377 ELHLAVHVPKPVEIFIRPPIPVGKAGEEWYQFQELTEKEEESRPKWFY 424 >AIJ27455.1 nitric oxide-associated protein [Elaeis guineensis] Length = 558 Score = 58.2 bits (139), Expect = 2e-07 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = -3 Query: 358 ETRITSLSDD--RQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIF 185 ET + DD R+L + HVPKPVEIFVRPP+P+GK G WY E RP+ F Sbjct: 498 ETDSNNAKDDSMRELHVAVHVPKPVEIFVRPPMPVGKTGGEWYHYQELTEKEEELRPQWF 557 Query: 184 Y 182 Y Sbjct: 558 Y 558 >XP_009386346.1 PREDICTED: putative nitric oxide synthase isoform X4 [Musa acuminata subsp. malaccensis] Length = 581 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 325 QLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +L L HVPKPVEIF+RPP+P+GK G WY E+RPK FY Sbjct: 534 ELHLAVHVPKPVEIFIRPPIPVGKAGEEWYQFQELTEKEEESRPKWFY 581 >XP_018676995.1 PREDICTED: putative nitric oxide synthase isoform X3 [Musa acuminata subsp. malaccensis] Length = 582 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 325 QLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +L L HVPKPVEIF+RPP+P+GK G WY E+RPK FY Sbjct: 535 ELHLAVHVPKPVEIFIRPPIPVGKAGEEWYQFQELTEKEEESRPKWFY 582 >XP_018676994.1 PREDICTED: putative nitric oxide synthase isoform X2 [Musa acuminata subsp. malaccensis] Length = 598 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 325 QLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +L L HVPKPVEIF+RPP+P+GK G WY E+RPK FY Sbjct: 551 ELHLAVHVPKPVEIFIRPPIPVGKAGEEWYQFQELTEKEEESRPKWFY 598 >XP_018676993.1 PREDICTED: putative nitric oxide synthase isoform X1 [Musa acuminata subsp. malaccensis] Length = 599 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 325 QLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +L L HVPKPVEIF+RPP+P+GK G WY E+RPK FY Sbjct: 552 ELHLAVHVPKPVEIFIRPPIPVGKAGEEWYQFQELTEKEEESRPKWFY 599 >XP_017699183.1 PREDICTED: putative nitric oxide synthase [Phoenix dactylifera] Length = 409 Score = 57.4 bits (137), Expect = 3e-07 Identities = 31/61 (50%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = -3 Query: 358 ETRITSLSDD--RQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIF 185 ET + DD R+L L HVPKPVEIFVR P+P+GK G WY E RPK F Sbjct: 349 ETDSNNAEDDSMRELHLSVHVPKPVEIFVRTPMPVGKAGGDWYHYQELTEKEEEVRPKWF 408 Query: 184 Y 182 Y Sbjct: 409 Y 409 >XP_016721149.1 PREDICTED: NO-associated protein 1, chloroplastic/mitochondrial-like isoform X2 [Gossypium hirsutum] Length = 566 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -3 Query: 328 RQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +QLD++ HVPKPVEIFVRP +P+GK G+ WY E RPK ++ Sbjct: 518 KQLDIVVHVPKPVEIFVRPSIPVGKAGAEWYQYRELTEKEEEIRPKWYF 566 >XP_017634396.1 PREDICTED: NO-associated protein 1, chloroplastic/mitochondrial isoform X2 [Gossypium arboreum] KHG27417.1 Nitric oxide synthase 1 -like protein [Gossypium arboreum] Length = 566 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -3 Query: 328 RQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +QLD++ HVPKPVEIFVRP +P+GK G+ WY E RPK ++ Sbjct: 518 KQLDIVVHVPKPVEIFVRPSIPVGKAGAEWYQYRELTEKEEEIRPKWYF 566 >XP_017634395.1 PREDICTED: NO-associated protein 1, chloroplastic/mitochondrial isoform X1 [Gossypium arboreum] Length = 569 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -3 Query: 328 RQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +QLD++ HVPKPVEIFVRP +P+GK G+ WY E RPK ++ Sbjct: 521 KQLDIVVHVPKPVEIFVRPSIPVGKAGAEWYQYRELTEKEEEIRPKWYF 569 >XP_016721148.1 PREDICTED: NO-associated protein 1, chloroplastic/mitochondrial-like isoform X1 [Gossypium hirsutum] Length = 569 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -3 Query: 328 RQLDLLFHVPKPVEIFVRPPVPIGKFGSLWYXXXXXXXXXXEARPKIFY 182 +QLD++ HVPKPVEIFVRP +P+GK G+ WY E RPK ++ Sbjct: 521 KQLDIVVHVPKPVEIFVRPSIPVGKAGAEWYQYRELTEKEEEIRPKWYF 569