BLASTX nr result
ID: Ephedra29_contig00019383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019383 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001757977.1 predicted protein [Physcomitrella patens] EDQ7721... 52 2e-10 ABF73921.1 disease resistance protein, partial [Arabidopsis thal... 54 3e-09 XP_008358428.1 PREDICTED: TMV resistance protein N-like [Malus d... 53 5e-09 CAB38788.1 putative protein [Arabidopsis thaliana] CAB80047.1 pu... 54 6e-09 NP_001031781.1 ADR1-like 1 [Arabidopsis thaliana] NP_001320123.1... 54 6e-09 BAD94804.1 putative protein, partial [Arabidopsis thaliana] 54 6e-09 ABF73929.1 disease resistance protein, partial [Arabidopsis thal... 54 6e-09 XP_010461189.1 PREDICTED: disease resistance protein ADR1 [Camel... 52 1e-08 XP_018728260.1 PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITU... 57 1e-08 XP_006283125.1 hypothetical protein CARUB_v10004147mg [Capsella ... 54 1e-08 KVI01724.1 Disease resistance protein [Cynara cardunculus var. s... 52 1e-08 XP_002867187.1 hypothetical protein ARALYDRAFT_913089 [Arabidops... 52 2e-08 XP_019575883.1 PREDICTED: probable disease resistance protein At... 54 2e-08 OAO98598.1 ADR1-L1 [Arabidopsis thaliana] 54 2e-08 ABF73966.1 disease resistance protein, partial [Arabidopsis thal... 54 2e-08 ABF73973.1 disease resistance protein, partial [Arabidopsis thal... 54 2e-08 ABF73923.1 disease resistance protein, partial [Arabidopsis thal... 54 2e-08 ABF73918.1 disease resistance protein, partial [Arabidopsis thal... 54 2e-08 ABF73988.1 disease resistance protein, partial [Arabidopsis thal... 54 2e-08 ABF73932.1 disease resistance protein, partial [Arabidopsis thal... 54 2e-08 >XP_001757977.1 predicted protein [Physcomitrella patens] EDQ77219.1 predicted protein [Physcomitrella patens] Length = 294 Score = 52.4 bits (124), Expect(2) = 2e-10 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = +2 Query: 185 CLP*SISELQSLKVLNIQDCESITCLPEDICKLGSLEELDLRGCCNL 325 CLP ++ L SLK LN+ C S+ CLP D+ L SL +LDL GC +L Sbjct: 130 CLPNDMANLSSLKKLNLSGCLSLICLPNDMANLSSLIKLDLSGCLSL 176 Score = 40.0 bits (92), Expect(2) = 2e-10 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 3 LERLDLLYCNKLVGLRSHLEGLVSLNCLNLSYC 101 LERLDL +C+ L L + LE L SL LNLS+C Sbjct: 68 LERLDLSHCSSLTSLPNELENLSSLKILNLSHC 100 >ABF73921.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73922.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73925.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73933.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73934.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73937.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73938.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73941.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73942.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73960.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73961.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73962.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73968.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73997.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 266 Score = 53.9 bits (128), Expect(2) = 3e-09 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLSELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 34.7 bits (78), Expect(2) = 3e-09 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPSSICGLTSLSCLSITNCPRLSELP 156 >XP_008358428.1 PREDICTED: TMV resistance protein N-like [Malus domestica] Length = 954 Score = 52.8 bits (125), Expect(2) = 5e-09 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = +2 Query: 197 SISELQSLKVLNIQDCESITCLPEDICKLGSLEELDLRGCCNLQLTTSQREWMATLK 367 SI L LK + +QDC+ ++C+P ICKL SLE LDL C NL+ E M LK Sbjct: 856 SIEFLHGLKKIELQDCKRLSCIPRSICKLKSLETLDLSWCSNLENFPEILEPMEHLK 912 Score = 35.0 bits (79), Expect(2) = 5e-09 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +3 Query: 3 LERLDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 + L L+ C LV L S++ L SL LNLS C K+E P Sbjct: 792 ISELSLVGCESLVSLPSNICKLKSLKXLNLSRCSKLENFP 831 >CAB38788.1 putative protein [Arabidopsis thaliana] CAB80047.1 putative protein [Arabidopsis thaliana] Length = 855 Score = 53.5 bits (127), Expect(2) = 6e-09 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 730 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 789 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 790 LKKLEKIDMRECC 802 Score = 33.9 bits (76), Expect(2) = 6e-09 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SL+CL+++ C ++ LP Sbjct: 700 LTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELP 736 >NP_001031781.1 ADR1-like 1 [Arabidopsis thaliana] NP_001320123.1 ADR1-like 1 [Arabidopsis thaliana] Q9SZA7.3 RecName: Full=Probable disease resistance protein At4g33300 BAH19667.1 AT4G33300 [Arabidopsis thaliana] AEE86203.1 ADR1-like 1 [Arabidopsis thaliana] AEE86204.1 ADR1-like 1 [Arabidopsis thaliana] Length = 816 Score = 53.5 bits (127), Expect(2) = 6e-09 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 691 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 750 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 751 LKKLEKIDMRECC 763 Score = 33.9 bits (76), Expect(2) = 6e-09 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SL+CL+++ C ++ LP Sbjct: 661 LTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELP 697 >BAD94804.1 putative protein, partial [Arabidopsis thaliana] Length = 366 Score = 53.5 bits (127), Expect(2) = 6e-09 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 241 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 300 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 301 LKKLEKIDMRECC 313 Score = 33.9 bits (76), Expect(2) = 6e-09 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SL+CL+++ C ++ LP Sbjct: 211 LTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELP 247 >ABF73929.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73943.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73948.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73950.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73951.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73965.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73993.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 266 Score = 53.5 bits (127), Expect(2) = 6e-09 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 33.9 bits (76), Expect(2) = 6e-09 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELP 156 >XP_010461189.1 PREDICTED: disease resistance protein ADR1 [Camelina sativa] Length = 783 Score = 51.6 bits (122), Expect(2) = 1e-08 Identities = 30/77 (38%), Positives = 42/77 (54%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K L R+ L+ LP I EL LK ++I C S++ LPE+I K Sbjct: 658 PRITELPKNLSNLQSLERLRLYACLELLFLPVEICELPCLKYVDISQCISLSSLPENIGK 717 Query: 281 LGSLEELDLRGCCNLQL 331 L +LE++D+RGC L L Sbjct: 718 LRTLEKIDMRGCSLLDL 734 Score = 35.0 bits (79), Expect(2) = 1e-08 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +3 Query: 3 LERLDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L L + +C+ LV L S++ G+ SL LN++ C +I LP Sbjct: 625 LSDLTIDHCDDLVELNSNISGMASLKSLNITNCPRITELP 664 >XP_018728260.1 PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 [Eucalyptus grandis] Length = 1452 Score = 57.4 bits (137), Expect(2) = 1e-08 Identities = 30/63 (47%), Positives = 44/63 (69%) Frame = +2 Query: 188 LP*SISELQSLKVLNIQDCESITCLPEDICKLGSLEELDLRGCCNLQLTTSQREWMATLK 367 LP SI +L++LK+LNI+ CE +T LP I KLG+LEELD+ C NL+ + +++LK Sbjct: 526 LPKSIGDLKNLKILNIKCCEKLTSLPSTISKLGNLEELDVSKCKNLE-GEIPTKGLSSLK 584 Query: 368 VFR 376 + R Sbjct: 585 ILR 587 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 3 LERLDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 LE L C LV + + LV+L+ L+L+ C K+ RLP Sbjct: 465 LESLCAEDCESLVQIPGSISHLVNLSILDLANCSKLCRLP 504 >XP_006283125.1 hypothetical protein CARUB_v10004147mg [Capsella rubella] EOA16023.1 hypothetical protein CARUB_v10004147mg [Capsella rubella] Length = 816 Score = 53.5 bits (127), Expect(2) = 1e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 691 PRLSELPKNLSKLQDLELLRLYACPELKALPGEICELTGLKYLDISQCVSLSCLPEEIGK 750 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 751 LTKLEKIDMRECC 763 Score = 32.7 bits (73), Expect(2) = 1e-08 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SLN L+++ C ++ LP Sbjct: 661 LTIDHCDDLVALPSSICGLASLNSLSITNCPRLSELP 697 >KVI01724.1 Disease resistance protein [Cynara cardunculus var. scolymus] Length = 785 Score = 51.6 bits (122), Expect(2) = 1e-08 Identities = 25/65 (38%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +2 Query: 188 LP*SISELQSLKVLNIQDCESITCLPEDICKLGSLEELDLRGCCNL-QLTTSQREWMATL 364 LP S++ L+ L +++I DC S+T LPE+I KLG L +++++GC + ++ TS +E T Sbjct: 692 LPESVTRLEKLSIVDISDCLSLTELPEEIGKLGGLRKINMKGCTGVHEIPTSAKELSNTQ 751 Query: 365 KVFRE 379 + E Sbjct: 752 VICNE 756 Score = 34.7 bits (78), Expect(2) = 1e-08 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 3 LERLDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L+R+ + CN++ L + L SL L+L C K+E+LP Sbjct: 654 LKRMSITNCNEMCELPEEIGNLTSLETLSLCSCTKLEKLP 693 >XP_002867187.1 hypothetical protein ARALYDRAFT_913089 [Arabidopsis lyrata subsp. lyrata] EFH43446.1 hypothetical protein ARALYDRAFT_913089 [Arabidopsis lyrata subsp. lyrata] Length = 816 Score = 52.0 bits (123), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K GK L + + L I EL LK L+I C S++CLPE+I K Sbjct: 691 PRLGELPKNLGKLQALEILRLYACPELKTLTGEICELLRLKYLDISQCVSLSCLPEEIGK 750 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 751 LKKLEKIDMRECC 763 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + GL SL+CL+++ C ++ LP Sbjct: 661 LTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELP 697 >XP_019575883.1 PREDICTED: probable disease resistance protein At4g33300, partial [Rhinolophus sinicus] Length = 818 Score = 54.3 bits (129), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 693 PRLGELPKKLSKLQALELLRLYACPELKALPVEICELPQLKYLDISQCVSLSCLPEEIGK 752 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 753 LKMLEKIDMRECC 765 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L S + G+ SLN L+++ C ++ LP Sbjct: 663 LTIDHCDDLVALPSSICGMTSLNSLSITNCPRLGELP 699 >OAO98598.1 ADR1-L1 [Arabidopsis thaliana] Length = 816 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 691 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 750 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 751 LKKLEKIDMRECC 763 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 661 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 697 >ABF73966.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 266 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 156 >ABF73973.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 266 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 156 >ABF73923.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73955.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73971.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73978.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 266 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 156 >ABF73918.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73919.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73920.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73924.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73926.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73927.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73928.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73930.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73931.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73935.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73936.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73939.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73940.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73944.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73945.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73946.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73947.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73949.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73952.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73953.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73954.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73956.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73957.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73958.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73959.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73963.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73964.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73967.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73969.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73970.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73972.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73974.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73975.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73976.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73977.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73979.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73980.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73981.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73982.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73983.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73984.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73985.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73986.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73987.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73989.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73990.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73991.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73992.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73994.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73995.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73996.1 disease resistance protein, partial [Arabidopsis thaliana] ABF73998.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 266 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 156 >ABF73988.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 265 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 156 >ABF73932.1 disease resistance protein, partial [Arabidopsis thaliana] Length = 260 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 29/73 (39%), Positives = 39/73 (53%) Frame = +2 Query: 101 PKNREASKAAGKASCLGRVGFTVLLQPPCLP*SISELQSLKVLNIQDCESITCLPEDICK 280 P+ E K K L + + LP I EL LK L+I C S++CLPE+I K Sbjct: 150 PRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGK 209 Query: 281 LGSLEELDLRGCC 319 L LE++D+R CC Sbjct: 210 LKKLEKIDMRECC 222 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 12 LDLLYCNKLVGLRSHLEGLVSLNCLNLSYCLKIERLP 122 L + +C+ LV L + GL SL+CL+++ C ++ LP Sbjct: 120 LTIDHCDDLVALPPSICGLTSLSCLSITNCPRLGELP 156