BLASTX nr result
ID: Ephedra29_contig00019159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019159 (787 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAN04624.1 conserved hypothetical protein [Mucor ambiguus] 59 2e-06 GAU89994.1 hypothetical protein RvY_02478 [Ramazzottius varieorn... 59 2e-06 >GAN04624.1 conserved hypothetical protein [Mucor ambiguus] Length = 364 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +2 Query: 389 FKNEMDKHAPDTSVEAYERVPVHQFGEAALKSMGWNPDRAIG--IRGGPPPLPYTVPVRA 562 F+++ DK +T++E YE +PV +FG A L+ +GWN IG + P P P V R Sbjct: 184 FRDDYDKRPDETTMEEYEHIPVEEFGAALLRGLGWNEGEGIGRNRKNAPAPPPAPVKQRE 243 Query: 563 SRLGLGA 583 + LGLGA Sbjct: 244 ALLGLGA 250 >GAU89994.1 hypothetical protein RvY_02478 [Ramazzottius varieornatus] Length = 385 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/67 (43%), Positives = 40/67 (59%) Frame = +2 Query: 392 KNEMDKHAPDTSVEAYERVPVHQFGEAALKSMGWNPDRAIGIRGGPPPLPYTVPVRASRL 571 K +D A ++++E YE +PV ++G A L+ MGW P+R IG PY V +R L Sbjct: 146 KLNVDLRAEESTMEDYEMIPVEKYGLALLRGMGWKPERGIGKTNKVSTKPYEVHMRPRGL 205 Query: 572 GLGATLK 592 GLGAT K Sbjct: 206 GLGATPK 212