BLASTX nr result
ID: Ephedra29_contig00019118
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019118 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018829295.1 PREDICTED: UPF0481 protein At3g47200-like [Juglan... 52 4e-06 >XP_018829295.1 PREDICTED: UPF0481 protein At3g47200-like [Juglans regia] Length = 442 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -1 Query: 201 EVPKCLRDLDKDAYHPQVVGLGPYHHHTATLPRFKELKKEAVLR 70 EVP ++DL+K AY PQ V GPYHH A L R +E K A+LR Sbjct: 34 EVPAWVKDLNKKAYMPQTVSFGPYHHREAPLQRMEEHKHRALLR 77