BLASTX nr result
ID: Ephedra29_contig00019063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019063 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAA24243.1 unnamed protein product, partial [Oryctolagus cuniculus] 79 2e-17 AAC32125.1 actin, partial [Picea mariana] 79 2e-17 AHA91825.1 actin-1, partial [Rosa hybrid cultivar] 79 2e-17 WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OI... 79 3e-17 JAT45276.1 Actin, partial [Anthurium amnicola] 79 3e-17 JAU90273.1 Actin, partial [Noccaea caerulescens] 79 3e-17 KTF96388.1 hypothetical protein cypCar_00042581 [Cyprinus carpio] 79 3e-17 EXL47609.1 actin, alpha skeletal muscle [Fusarium oxysporum f. s... 78 4e-17 AAA74457.1 alpha-actin, partial [Rattus norvegicus] 77 4e-17 AEG78680.1 actin, partial [Erythroxylum coca] 77 4e-17 ANH56392.1 actin alpha cardiac muscle 1 precursor, partial [Homo... 77 4e-17 AML60265.1 actin 4, partial [Morus alba] 77 4e-17 AAA60560.1 smooth muscle alpha-actin, partial [Homo sapiens] 77 4e-17 JAU26149.1 Actin, partial [Noccaea caerulescens] 79 4e-17 KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] 77 4e-17 JAU98109.1 Actin [Noccaea caerulescens] 79 4e-17 AFK44654.1 unknown [Lotus japonicus] 79 4e-17 CBY40688.1 unnamed protein product [Oikopleura dioica] 79 4e-17 XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphal... 79 5e-17 XP_014564422.1 actin [Ordospora colligata OC4] KHN70380.1 actin ... 84 5e-17 >CAA24243.1 unnamed protein product, partial [Oryctolagus cuniculus] Length = 67 Score = 79.0 bits (193), Expect = 2e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWITK E++E GPSIVHRKCF Sbjct: 29 YSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 67 >AAC32125.1 actin, partial [Picea mariana] Length = 53 Score = 78.6 bits (192), Expect = 2e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI KAE++E GPSIVHRKCF Sbjct: 15 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 53 >AHA91825.1 actin-1, partial [Rosa hybrid cultivar] Length = 84 Score = 79.0 bits (193), Expect = 2e-17 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+KAE++E GPSIVHRKCF Sbjct: 46 YSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 84 >WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OIC63224.1 hypothetical protein A7L55_18690 [Acinetobacter baumannii] Length = 71 Score = 78.6 bits (192), Expect = 3e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI KAE++E GPSIVHRKCF Sbjct: 33 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 71 >JAT45276.1 Actin, partial [Anthurium amnicola] Length = 100 Score = 79.3 bits (194), Expect = 3e-17 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWITKAE++E GP+IVHRKCF Sbjct: 62 YSVWIGGSILASLSTFQQMWITKAEYDESGPAIVHRKCF 100 >JAU90273.1 Actin, partial [Noccaea caerulescens] Length = 79 Score = 78.6 bits (192), Expect = 3e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI KAE++E GPSIVHRKCF Sbjct: 41 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 79 >KTF96388.1 hypothetical protein cypCar_00042581 [Cyprinus carpio] Length = 93 Score = 79.0 bits (193), Expect = 3e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWITK E++E GPSIVHRKCF Sbjct: 55 YSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 93 >EXL47609.1 actin, alpha skeletal muscle [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 71 Score = 78.2 bits (191), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMW+TK E++E GPSIVHRKCF Sbjct: 33 YSVWIGGSILASLSTFQQMWVTKQEYDESGPSIVHRKCF 71 >AAA74457.1 alpha-actin, partial [Rattus norvegicus] Length = 42 Score = 77.4 bits (189), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+K E++E GPSIVHRKCF Sbjct: 4 YSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 42 >AEG78680.1 actin, partial [Erythroxylum coca] Length = 45 Score = 77.4 bits (189), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+K E++E GPSIVHRKCF Sbjct: 7 YSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 45 >ANH56392.1 actin alpha cardiac muscle 1 precursor, partial [Homo sapiens] Length = 47 Score = 77.4 bits (189), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+K E++E GPSIVHRKCF Sbjct: 9 YSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 47 >AML60265.1 actin 4, partial [Morus alba] Length = 47 Score = 77.4 bits (189), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+K E++E GPSIVHRKCF Sbjct: 9 YSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 47 >AAA60560.1 smooth muscle alpha-actin, partial [Homo sapiens] Length = 47 Score = 77.4 bits (189), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+K E++E GPSIVHRKCF Sbjct: 9 YSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 47 >JAU26149.1 Actin, partial [Noccaea caerulescens] Length = 90 Score = 78.6 bits (192), Expect = 4e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI KAE++E GPSIVHRKCF Sbjct: 52 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 90 >KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] Length = 51 Score = 77.4 bits (189), Expect = 4e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+K E++E GPSIVHRKCF Sbjct: 13 YSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 51 >JAU98109.1 Actin [Noccaea caerulescens] Length = 93 Score = 78.6 bits (192), Expect = 4e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI KAE++E GPSIVHRKCF Sbjct: 55 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 93 >AFK44654.1 unknown [Lotus japonicus] Length = 93 Score = 78.6 bits (192), Expect = 4e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMW+TKAE++E GPSIVH+KCF Sbjct: 55 YSVWIGGSILASLSTFQQMWVTKAEYDESGPSIVHQKCF 93 >CBY40688.1 unnamed protein product [Oikopleura dioica] Length = 93 Score = 78.6 bits (192), Expect = 4e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQ MWITKAE++E GPSIVHRKCF Sbjct: 55 YSVWIGGSILASLSTFQAMWITKAEYDEAGPSIVHRKCF 93 >XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphalaria glabrata] Length = 107 Score = 79.0 bits (193), Expect = 5e-17 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMWI+KAE++E GPSIVHRKCF Sbjct: 69 YSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 107 >XP_014564422.1 actin [Ordospora colligata OC4] KHN70380.1 actin [Ordospora colligata OC4] Length = 375 Score = 84.0 bits (206), Expect = 5e-17 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 294 YSVWIGGSILASLSTFQQMWITKAEFEECGPSIVHRKCF 178 YSVWIGGSILASLSTFQQMW+TKAE++ECGPSIVHRKCF Sbjct: 337 YSVWIGGSILASLSTFQQMWVTKAEYQECGPSIVHRKCF 375