BLASTX nr result
ID: Ephedra29_contig00019032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00019032 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010044451.1 PREDICTED: putative pentatricopeptide repeat-cont... 53 7e-06 >XP_010044451.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial [Eucalyptus grandis] KCW86540.1 hypothetical protein EUGRSUZ_B03180 [Eucalyptus grandis] Length = 782 Score = 52.8 bits (125), Expect = 7e-06 Identities = 23/54 (42%), Positives = 36/54 (66%) Frame = +2 Query: 116 YEPLFRASQNASTVAQIHGHIVADGLQQNVFLATQLTHKYYTHGRLQNARMVFE 277 Y PLFRA + TVAQ+HGH++ GL ++ +T+L Y G L+++R+VF+ Sbjct: 4 YMPLFRACASLRTVAQLHGHLLVTGLHRDPLASTRLIQSYAEMGSLESSRLVFD 57