BLASTX nr result
ID: Ephedra29_contig00018980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00018980 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010257914.1 PREDICTED: transcription factor BIM2 isoform X3 [... 55 3e-07 XP_011623243.1 PREDICTED: transcription factor BIM2 [Amborella t... 53 2e-06 >XP_010257914.1 PREDICTED: transcription factor BIM2 isoform X3 [Nelumbo nucifera] Length = 558 Score = 55.5 bits (132), Expect = 3e-07 Identities = 29/52 (55%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = +3 Query: 42 PPQHPF--QGSKTPHDFLSLYAEPNSNHSDSRSNPGNSMHLTTHDFLQPLER 191 P PF +G KT HDFLSLY P+ H D R P + L THDFLQPLER Sbjct: 4 PQPRPFGTEGKKTTHDFLSLYGHPSFQHQDPRP-PHGFLILKTHDFLQPLER 54 >XP_011623243.1 PREDICTED: transcription factor BIM2 [Amborella trichopoda] Length = 586 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = +3 Query: 30 MDLNPPQHPF--QGSKTPHDFLSLYAEPNSNHSDSRSNPGNSMHLTTHDFLQPLER 191 M+L PQ PF +G+K HDFLSLY E + +++ ++ G S +L T DFLQPLE+ Sbjct: 1 MELPQPQLPFTTEGAKPTHDFLSLYNEASFQNTEPGASQGFSSYLKTQDFLQPLEK 56