BLASTX nr result
ID: Ephedra29_contig00018886
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00018886 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019421901.1 PREDICTED: putative DNA (cytosine-5)-methyltransf... 53 7e-06 XP_019421903.1 PREDICTED: putative DNA (cytosine-5)-methyltransf... 52 1e-05 >XP_019421901.1 PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform X2 [Lupinus angustifolius] Length = 843 Score = 52.8 bits (125), Expect = 7e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -2 Query: 296 SDLCTVSGSTMEIKVEDPI*ECSLLDLYTGCGGISTGLCFGVSLVGLKLI 147 S + + SGS + + + E SLLDLY+GCG +STGLCFG S+ G+KL+ Sbjct: 247 STISSESGSNGFVDDKTVLAEWSLLDLYSGCGAMSTGLCFGASISGIKLV 296 >XP_019421903.1 PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform X3 [Lupinus angustifolius] Length = 843 Score = 52.4 bits (124), Expect = 1e-05 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -2 Query: 296 SDLCTVSGSTMEIKVEDPI*ECSLLDLYTGCGGISTGLCFGVSLVGLKLI 147 S + + SGS + + + E SLLDLY+GCG +STGLCFG S+ G+KL+ Sbjct: 247 STISSESGSNGFVGDKTVLAEWSLLDLYSGCGAMSTGLCFGASISGIKLV 296