BLASTX nr result
ID: Ephedra29_contig00018532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00018532 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011071056.1 PREDICTED: vegetative incompatibility protein HET... 52 5e-06 >XP_011071056.1 PREDICTED: vegetative incompatibility protein HET-E-1-like [Sesamum indicum] Length = 409 Score = 52.0 bits (123), Expect = 5e-06 Identities = 23/54 (42%), Positives = 32/54 (59%) Frame = +2 Query: 59 DNHIIIWRRKPELLELKDFCKENGGAMKSIVGWRDLVFTAHHDHKIRIWKVLSN 220 + I +W R P L E A+KSIV D +FTAHHDHKIR+W++ ++ Sbjct: 92 NGEIRVWDRNPSSLSQNYIVSEGYSAVKSIVVLGDKLFTAHHDHKIRVWRIANS 145