BLASTX nr result
ID: Ephedra29_contig00018466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00018466 (434 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_012627503.1 hypothetical protein [Cyanothece sp. PCC 7425] AC... 53 9e-07 >WP_012627503.1 hypothetical protein [Cyanothece sp. PCC 7425] ACL44422.1 leucine-rich repeat protein [Cyanothece sp. PCC 7425] Length = 72 Score = 53.1 bits (126), Expect = 9e-07 Identities = 26/53 (49%), Positives = 39/53 (73%) Frame = +1 Query: 262 EKALARISKALYAKSQKLDLSHLQLQRVPESIQFLWKILKLDLSNNNLETIPE 420 EKA RI +A +S++LDL++L L VPES+ L ++ KLD+S NNL+++PE Sbjct: 8 EKAEERIEQARQQQSKELDLNNLSLTEVPESLNSLTQLQKLDISRNNLKSLPE 60