BLASTX nr result
ID: Ephedra29_contig00018007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00018007 (348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE28675.1 hypothetical protein AXG93_312s1040 [Marchantia polym... 56 3e-07 >OAE28675.1 hypothetical protein AXG93_312s1040 [Marchantia polymorpha subsp. polymorpha] Length = 164 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 5/70 (7%) Frame = -1 Query: 228 LIDKKIIPRLQHYAINNNXA-----VSYLRTNYREYKRHKEDIFRKSVQAAIGIVIQNIR 64 ++DK ++PRL+ YA NN+ + V YLR NY+EY+R ++ FRK V A+ I+ + + Sbjct: 28 ILDKLLLPRLEQYAQNNSISNIDNTVEYLRRNYQEYRRKQQGPFRKIVTRAVQIIKRRVL 87 Query: 63 QEDLEEQQEI 34 E+ E++ I Sbjct: 88 PEESAEEENI 97