BLASTX nr result
ID: Ephedra29_contig00017849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00017849 (216 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE23975.1 hypothetical protein AXG93_4625s1010 [Marchantia poly... 53 2e-06 XP_002990493.1 hypothetical protein SELMODRAFT_428953 [Selaginel... 52 4e-06 >OAE23975.1 hypothetical protein AXG93_4625s1010 [Marchantia polymorpha subsp. polymorpha] Length = 620 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -1 Query: 216 QTEKIARLFEAAYPDVAQELGIADDVI*MLAVVDGLHARSIFYEH 82 +T A+L E YP V++EL + DDVI +L V +GLH R IFYEH Sbjct: 571 ETHSAAKLLELLYPRVSEELELIDDVIMLLTVAEGLHGRPIFYEH 615 >XP_002990493.1 hypothetical protein SELMODRAFT_428953 [Selaginella moellendorffii] EFJ08370.1 hypothetical protein SELMODRAFT_428953 [Selaginella moellendorffii] Length = 272 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = -1 Query: 216 QTEKIARLFEAAYPDVAQELGIADDVI*MLAVVDGLHARSIFYEHC 79 +T A+L +A Y +V++EL I DDVI +L V +G HAR IFYE C Sbjct: 223 ETTTTAKLLQAQYKEVSEELDITDDVIMVLTVAEGWHARPIFYESC 268