BLASTX nr result
ID: Ephedra29_contig00017624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00017624 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEX11972.1 hypothetical protein 0_18318_01, partial [Pinus taeda... 59 4e-09 XP_009388279.1 PREDICTED: dirigent protein 22-like [Musa acumina... 59 2e-08 XP_010243405.1 PREDICTED: dirigent protein 21-like [Nelumbo nuci... 59 2e-08 KDO70858.1 hypothetical protein CISIN_1g043227mg [Citrus sinensis] 59 3e-08 XP_006492824.1 PREDICTED: dirigent protein 22-like [Citrus sinen... 59 3e-08 ABD52122.1 dirigent-like protein pDIR11 [Picea sitchensis] 58 4e-08 KVH88920.1 Plant disease resistance response protein [Cynara car... 58 4e-08 XP_006373795.1 hypothetical protein POPTR_0016s06080g, partial [... 56 5e-08 XP_020089211.1 dirigent protein 22-like [Ananas comosus] 58 5e-08 OAY80365.1 Dirigent protein 19 [Ananas comosus] 58 5e-08 AFG63904.1 hypothetical protein CL2213Contig1_03, partial [Pinus... 55 6e-08 AEW08907.1 hypothetical protein CL2213Contig1_03, partial [Pinus... 55 6e-08 XP_007162357.1 hypothetical protein PHAVU_001G145100g [Phaseolus... 58 6e-08 XP_012487055.1 PREDICTED: dirigent protein 22-like [Gossypium ra... 57 9e-08 XP_019165630.1 PREDICTED: dirigent protein 22-like [Ipomoea nil] 57 9e-08 XP_019165629.1 PREDICTED: dirigent protein 22-like [Ipomoea nil] 57 1e-07 ABD52125.1 dirigent-like protein pDIR14 [Picea engelmannii x Pic... 56 2e-07 ACN40946.1 unknown [Picea sitchensis] 56 2e-07 XP_012076044.1 PREDICTED: dirigent protein 22-like [Jatropha cur... 56 2e-07 CAN76521.1 hypothetical protein VITISV_000433, partial [Vitis vi... 55 3e-07 >AEX11972.1 hypothetical protein 0_18318_01, partial [Pinus taeda] AEX11973.1 hypothetical protein 0_18318_01, partial [Pinus taeda] Length = 117 Score = 59.3 bits (142), Expect = 4e-09 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGYA ARTHS D KTGNAVVEYDVTV HY Sbjct: 86 RLARGYALARTHSFDLKTGNAVVEYDVTVLHY 117 >XP_009388279.1 PREDICTED: dirigent protein 22-like [Musa acuminata subsp. malaccensis] Length = 196 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGYAQARTHS DPKTG+AVVEY+V V HY Sbjct: 165 RLARGYAQARTHSFDPKTGDAVVEYNVFVMHY 196 >XP_010243405.1 PREDICTED: dirigent protein 21-like [Nelumbo nucifera] Length = 154 Score = 58.5 bits (140), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+LDPKTGNAVVEY+V V HY Sbjct: 123 RFARGYAQAKTHTLDPKTGNAVVEYNVFVVHY 154 >KDO70858.1 hypothetical protein CISIN_1g043227mg [Citrus sinensis] Length = 190 Score = 58.5 bits (140), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+ DPKTG+AVVEY+V VFHY Sbjct: 159 RFARGYAQAKTHTFDPKTGDAVVEYNVNVFHY 190 >XP_006492824.1 PREDICTED: dirigent protein 22-like [Citrus sinensis] Length = 190 Score = 58.5 bits (140), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+ DPKTG+AVVEY+V VFHY Sbjct: 159 RFARGYAQAKTHTFDPKTGDAVVEYNVNVFHY 190 >ABD52122.1 dirigent-like protein pDIR11 [Picea sitchensis] Length = 186 Score = 58.2 bits (139), Expect = 4e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGYA ARTHS+D KTGNAVVEY+VTV HY Sbjct: 155 RLARGYALARTHSIDLKTGNAVVEYNVTVLHY 186 >KVH88920.1 Plant disease resistance response protein [Cynara cardunculus var. scolymus] Length = 190 Score = 58.2 bits (139), Expect = 4e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+THSLD KTGNAVVEYDV V HY Sbjct: 159 RFARGYAQAKTHSLDYKTGNAVVEYDVFVLHY 190 >XP_006373795.1 hypothetical protein POPTR_0016s06080g, partial [Populus trichocarpa] ERP51592.1 hypothetical protein POPTR_0016s06080g, partial [Populus trichocarpa] Length = 88 Score = 55.8 bits (133), Expect = 5e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGYAQA+TH +D KTGNA VEY+V VFHY Sbjct: 57 RLARGYAQAKTHEIDFKTGNATVEYNVYVFHY 88 >XP_020089211.1 dirigent protein 22-like [Ananas comosus] Length = 201 Score = 58.2 bits (139), Expect = 5e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGY QARTHSLD KTGNAVVEYDV V+H+ Sbjct: 170 RLARGYVQARTHSLDVKTGNAVVEYDVFVWHH 201 >OAY80365.1 Dirigent protein 19 [Ananas comosus] Length = 206 Score = 58.2 bits (139), Expect = 5e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGY QARTHSLD KTGNAVVEYDV V+H+ Sbjct: 175 RLARGYVQARTHSLDVKTGNAVVEYDVFVWHH 206 >AFG63904.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63905.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63907.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63910.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63911.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] Length = 50 Score = 54.7 bits (130), Expect = 6e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFH 239 RLARGYA ARTHS D KTGNAVVEY+VTV H Sbjct: 14 RLARGYALARTHSFDLKTGNAVVEYNVTVLH 44 >AEW08907.1 hypothetical protein CL2213Contig1_03, partial [Pinus radiata] AFG63897.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63898.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63899.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63900.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63901.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63902.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63903.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63906.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63908.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63909.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] Length = 50 Score = 54.7 bits (130), Expect = 6e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFH 239 RLARGYA ARTHS D KTGNAVVEY+VTV H Sbjct: 14 RLARGYALARTHSFDLKTGNAVVEYNVTVLH 44 >XP_007162357.1 hypothetical protein PHAVU_001G145100g [Phaseolus vulgaris] ESW34351.1 hypothetical protein PHAVU_001G145100g [Phaseolus vulgaris] Length = 192 Score = 57.8 bits (138), Expect = 6e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+ DPKTG+AVVEY+V VFHY Sbjct: 161 RFARGYAQAKTHTFDPKTGDAVVEYNVYVFHY 192 >XP_012487055.1 PREDICTED: dirigent protein 22-like [Gossypium raimondii] KJB37916.1 hypothetical protein B456_006G230500 [Gossypium raimondii] Length = 192 Score = 57.4 bits (137), Expect = 9e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+LD KTGNAVVEY+V VFHY Sbjct: 161 RFARGYAQAKTHTLDLKTGNAVVEYNVYVFHY 192 >XP_019165630.1 PREDICTED: dirigent protein 22-like [Ipomoea nil] Length = 195 Score = 57.4 bits (137), Expect = 9e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+LD KTGNAVVEY+V VFHY Sbjct: 164 RFARGYAQAKTHTLDIKTGNAVVEYNVYVFHY 195 >XP_019165629.1 PREDICTED: dirigent protein 22-like [Ipomoea nil] Length = 200 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQA+TH+ DPKTG+AVVEY+V VFHY Sbjct: 169 RFARGYAQAKTHTYDPKTGDAVVEYNVYVFHY 200 >ABD52125.1 dirigent-like protein pDIR14 [Picea engelmannii x Picea glauca] Length = 184 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGYA A THS+D KTGNAVVEY+VTV HY Sbjct: 153 RLARGYALAHTHSIDLKTGNAVVEYNVTVLHY 184 >ACN40946.1 unknown [Picea sitchensis] Length = 184 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 RLARGYA A THS+D KTGNAVVEY+VTV HY Sbjct: 153 RLARGYALAHTHSIDLKTGNAVVEYNVTVLHY 184 >XP_012076044.1 PREDICTED: dirigent protein 22-like [Jatropha curcas] KDP34475.1 hypothetical protein JCGZ_12758 [Jatropha curcas] Length = 188 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQARTH+ +PKTG+AVVEY++ VFHY Sbjct: 157 RFARGYAQARTHTYNPKTGDAVVEYNIYVFHY 188 >CAN76521.1 hypothetical protein VITISV_000433, partial [Vitis vinifera] Length = 153 Score = 55.5 bits (132), Expect = 3e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 331 RLARGYAQARTHSLDPKTGNAVVEYDVTVFHY 236 R ARGYAQARTH+ +PKTG+ VVEY+V VFHY Sbjct: 122 RFARGYAQARTHTFNPKTGDVVVEYNVYVFHY 153