BLASTX nr result
ID: Ephedra29_contig00017431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00017431 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_002519960.1 ATP synthase CF1 epsilon chain (chloroplast) [Eph... 137 2e-40 YP_009117850.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetu... 102 2e-26 ANZ53634.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum gn... 102 3e-26 ANZ53568.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum gn... 102 4e-26 YP_002519776.1 ATP synthase CF1 epsilon chain [Gnetum parvifoliu... 102 4e-26 YP_001876583.1 ATP synthase CF1 epsilon subunit [Welwitschia mir... 100 2e-25 YP_009193277.1 ATP synthase CF1 epsilon chain (chloroplast) [Gne... 100 3e-25 YP_007890250.1 ATP synthase CF1 epsilon chain (chloroplast) [Cep... 92 2e-22 YP_009059747.1 ATP synthase CF1 epsilon chain (chloroplast) [Ame... 92 3e-22 YP_007474818.1 ATP synthase CF1 epsilon subunit (chloroplast) [T... 92 3e-22 YP_009144108.1 ATP synthase CF1 epsilon chain (chloroplast) [Wol... 91 8e-22 YP_008965037.1 ATP synthase CF1 epsilon chain (chloroplast) [Aga... 91 8e-22 YP_004891366.1 ATP synthase CF1 epsilon chain (chloroplast) [Cep... 91 1e-21 YP_009233160.1 ATP synthase CF1 epsilon chain (chloroplast) [Tor... 90 2e-21 YP_009121307.1 ATP synthase CF1 epsilon chain (plastid) [Araucar... 90 2e-21 KYP58869.1 hypothetical protein KK1_014291 [Cajanus cajan] 88 2e-21 YP_001312208.1 ATP synthase CF1 epsilon chain [Cycas taitungensi... 89 5e-21 YP_009154358.1 ATP synthase CF1 epsilon subunit (chloroplast) [M... 89 6e-21 XP_013459392.1 ATP synthase, delta/epsilon chain, long alpha-hel... 87 7e-21 YP_009259097.1 ATP synthase CF1 epsilon subunit (chloroplast) [S... 88 9e-21 >YP_002519960.1 ATP synthase CF1 epsilon chain (chloroplast) [Ephedra equisetina] YP_009231428.1 ATP synthase CF1 epsilon chain (chloroplast) [Ephedra foeminea] BAH11328.1 ATP synthase CF1 epsilon chain (chloroplast) [Ephedra equisetina] ALV90144.1 ATP synthase CF1 epsilon chain (chloroplast) [Ephedra foeminea] Length = 135 Score = 137 bits (346), Expect = 2e-40 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR Sbjct: 66 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 125 Query: 44 LEAINAVLPN 15 LEAINAVLPN Sbjct: 126 LEAINAVLPN 135 >YP_009117850.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum gnemon] AJE71478.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum gnemon] Length = 142 Score = 102 bits (255), Expect = 2e-26 Identities = 50/69 (72%), Positives = 58/69 (84%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI++NQ++L VNDAEKG DIDPQEAQE QAKA N GKRQKIE +LA+KRARTR Sbjct: 66 FAKIDKNQVLLLVNDAEKGADIDPQEAQETLNQAKAGLNMAEGKRQKIEAELAVKRARTR 125 Query: 44 LEAINAVLP 18 LEAI+A+LP Sbjct: 126 LEAISAILP 134 >ANZ53634.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum gnemon] Length = 142 Score = 102 bits (254), Expect = 3e-26 Identities = 50/69 (72%), Positives = 58/69 (84%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI++NQ++L VNDAEKG DID QEAQE F QAKA N GKRQKIE +LA+KRARTR Sbjct: 66 FAKIDKNQVLLLVNDAEKGADIDQQEAQETFNQAKAGLNMAKGKRQKIEAELAVKRARTR 125 Query: 44 LEAINAVLP 18 LEAI+A+LP Sbjct: 126 LEAISAILP 134 >ANZ53568.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum gnemon] Length = 142 Score = 102 bits (253), Expect = 4e-26 Identities = 50/69 (72%), Positives = 58/69 (84%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI++NQ++L VNDAEKG DID QEAQE F QAKA N GKRQKIE +LA+KRARTR Sbjct: 66 FAKIDKNQVLLLVNDAEKGADIDQQEAQETFNQAKAGLNMAEGKRQKIEAELAVKRARTR 125 Query: 44 LEAINAVLP 18 LEAI+A+LP Sbjct: 126 LEAISAILP 134 >YP_002519776.1 ATP synthase CF1 epsilon chain [Gnetum parvifolium] YP_008082201.1 ATP synthase CF1 epsilon chain (chloroplast) [Gnetum montanum] BAF64855.1 ATP synthase CF1 epsilon subunit (chloroplast) [Gnetum parvifolium] BAH11287.1 ATP synthase CF1 epsilon chain (chloroplast) [Gnetum parvifolium] AGL11046.1 ATP synthase CF1 epsilon chain (chloroplast) [Gnetum montanum] ANZ53700.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum parvifolium] ANZ53766.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum parvifolium] ANZ53832.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum parvifolium] ANZ53898.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum hainanense] ANZ53964.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum hainanense] ANZ54030.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum montanum] ANZ54096.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum montanum] ANZ54162.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum pendulum] ANZ54228.1 ATP synthase CF1 epsilon subunit (plastid) [Gnetum pendulum] Length = 142 Score = 102 bits (253), Expect = 4e-26 Identities = 50/69 (72%), Positives = 58/69 (84%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI++NQ++L VNDAEKG DID QEAQE F QAKA N GKRQKIE +LA+KRARTR Sbjct: 66 FAKIDKNQVLLLVNDAEKGADIDQQEAQETFNQAKAGLNMAEGKRQKIEAELAVKRARTR 125 Query: 44 LEAINAVLP 18 LEAI+A+LP Sbjct: 126 LEAISAILP 134 >YP_001876583.1 ATP synthase CF1 epsilon subunit [Welwitschia mirabilis] B2Y1W6.1 RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName: Full=ATP synthase F1 sector epsilon subunit; AltName: Full=F-ATPase epsilon subunit ABY26796.1 ATP synthase CF1 epsilon subunit (chloroplast) [Welwitschia mirabilis] BAH11222.1 ATP synthase CF1 epsilon chain (chloroplast) [Welwitschia mirabilis] AMA21056.1 ATP synthase CF1 epsilon subunit (plastid) [Welwitschia mirabilis] Length = 139 Score = 100 bits (248), Expect = 2e-25 Identities = 48/69 (69%), Positives = 57/69 (82%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+++L V DAEKGVDIDPQEAQE F +AK N N+ GKRQKIE DLA+K+ARTR Sbjct: 66 FAKIDNNELLLLVYDAEKGVDIDPQEAQETFNKAKTNLNKAEGKRQKIEADLAVKKARTR 125 Query: 44 LEAINAVLP 18 LEAIN + P Sbjct: 126 LEAINVLTP 134 >YP_009193277.1 ATP synthase CF1 epsilon chain (chloroplast) [Gnetum ula] BAN16884.1 ATP synthase CF1 epsilon chain (chloroplast) [Gnetum ula] BAT70187.1 ATP synthase CF1 epsilon chain (chloroplast) [Gnetum ula] Length = 142 Score = 99.8 bits (247), Expect = 3e-25 Identities = 49/69 (71%), Positives = 57/69 (82%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI++NQ++L VNDAEKG DID QEAQE QAKA N GKRQKIE +LA+KRARTR Sbjct: 66 FAKIDKNQVLLLVNDAEKGADIDQQEAQETLNQAKAGLNMAEGKRQKIEAELAVKRARTR 125 Query: 44 LEAINAVLP 18 LEAI+A+LP Sbjct: 126 LEAISAILP 134 >YP_007890250.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus oliveri] AFZ65552.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus oliveri] AIL95839.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus oliveri] AIL95841.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus oliveri] AIL95843.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus oliveri] Length = 135 Score = 92.4 bits (228), Expect = 2e-22 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+I L VN AE+G+DIDPQEAQE F+ AKA+ R GKRQ IE D+A+KRART Sbjct: 66 FAKIDNNEITLLVNSAERGIDIDPQEAQESFRSAKADLARAEGKRQAIEADVALKRARTL 125 Query: 44 LEAINAVLP 18 LEA++A+LP Sbjct: 126 LEAVDAILP 134 >YP_009059747.1 ATP synthase CF1 epsilon chain (chloroplast) [Amentotaxus formosana] YP_009159009.1 ATP synthase CF1 epsilon chain (chloroplast) [Amentotaxus argotaenia] BAP47737.1 ATP synthase CF1 epsilon chain (chloroplast) [Amentotaxus formosana] AKP55016.1 ATP synthase CF1 epsilon chain (chloroplast) [Amentotaxus argotaenia] Length = 135 Score = 92.0 bits (227), Expect = 3e-22 Identities = 44/69 (63%), Positives = 58/69 (84%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+I L VN+AE+G+DIDP+EAQE F+ AKA+ + GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNEITLLVNNAERGIDIDPREAQESFRLAKADLAQAKGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVLP 18 LEA++A+LP Sbjct: 126 LEAVDAILP 134 >YP_007474818.1 ATP synthase CF1 epsilon subunit (chloroplast) [Taxus mairei] AEX99367.1 ATP synthase CF1 epsilon subunit (chloroplast) [Taxus mairei] AEX99443.1 ATP synthase CF1 epsilon subunit (chloroplast) [Taxus mairei] AEX99605.1 ATP synthase CF1 epsilon subunit (chloroplast) [Taxus mairei] AHL69545.1 AtpE (chloroplast) [Taxus mairei] BAP47819.1 ATP synthase CF1 epsilon chain (chloroplast) [Taxus mairei] AOQ30733.1 AtpE (chloroplast) [Taxus wallichiana var. chinensis] Length = 135 Score = 92.0 bits (227), Expect = 3e-22 Identities = 43/69 (62%), Positives = 57/69 (82%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+I L VN+AE+G+DIDP+EAQE F+ AK + R GK+Q IE D+A+KRARTR Sbjct: 66 FAKIDNNEITLLVNNAERGIDIDPREAQETFRLAKVDLGRAEGKKQAIEADVALKRARTR 125 Query: 44 LEAINAVLP 18 LEA++A+LP Sbjct: 126 LEAVDAILP 134 >YP_009144108.1 ATP synthase CF1 epsilon chain (chloroplast) [Wollemia nobilis] AKE36622.1 ATP synthase CF1 epsilon chain (chloroplast) [Wollemia nobilis] Length = 136 Score = 90.9 bits (224), Expect = 8e-22 Identities = 46/70 (65%), Positives = 56/70 (80%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ NQI + VN+AE+G+DID QEAQE F+ AKA+ R GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNQITVLVNNAERGIDIDLQEAQESFRIAKADLARAQGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVLPN 15 LEAI A+ PN Sbjct: 126 LEAIGAISPN 135 >YP_008965037.1 ATP synthase CF1 epsilon chain (chloroplast) [Agathis dammara] BAK86752.1 ATP synthase CF1 epsilon chain (chloroplast) [Agathis dammara] AER45648.1 atpE (chloroplast) [Agathis australis] BAO19721.1 ATP synthase CF1 epsilon chain (chloroplast) (chloroplast) [Agathis dammara] Length = 136 Score = 90.9 bits (224), Expect = 8e-22 Identities = 46/70 (65%), Positives = 56/70 (80%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ NQI + VN+AE+G+DID QEAQE F+ AKA+ R GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNQITVLVNNAERGIDIDLQEAQESFRIAKADLARAQGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVLPN 15 LEAI A+ PN Sbjct: 126 LEAIGAISPN 135 >YP_004891366.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus wilsoniana] BAL03747.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus wilsoniana] AIL95845.1 ATP synthase CF1 epsilon chain (chloroplast) [Cephalotaxus fortunei] Length = 135 Score = 90.5 bits (223), Expect = 1e-21 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ ++I L VN AE+G+DIDPQEAQE F+ AKA+ R GKRQ IE D+A+KRART Sbjct: 66 FAKIDNDEITLLVNSAERGIDIDPQEAQESFRSAKADLARAEGKRQAIEADVALKRARTL 125 Query: 44 LEAINAVLP 18 LEA++A+LP Sbjct: 126 LEAVDAILP 134 >YP_009233160.1 ATP synthase CF1 epsilon chain (chloroplast) [Torreya fargesii] AMB21053.1 ATP synthase CF1 epsilon chain (chloroplast) [Torreya fargesii] APX55456.1 ATP synthase CF1 epsilon chain (chloroplast) [Torreya jackii] Length = 135 Score = 89.7 bits (221), Expect = 2e-21 Identities = 43/69 (62%), Positives = 58/69 (84%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+I L VN+AE+G+DIDP+EAQE ++ AKA+ + GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNEITLLVNNAERGMDIDPREAQESYRLAKADLAQAEGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVLP 18 LEA++A+LP Sbjct: 126 LEAVDAILP 134 >YP_009121307.1 ATP synthase CF1 epsilon chain (plastid) [Araucaria heterophylla] AIW58365.1 ATP synthase CF1 epsilon chain (plastid) [Araucaria heterophylla] AJF41943.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria muelleri] AJF42023.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria scopulorum] AJF42106.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria muelleri] AJF42188.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria bernieri] AJF42268.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria luxurians] AJF42347.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria subulata] AJF42429.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria columnaris] AJF42512.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria rulei] AJF42594.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria scopulorum] AJF42671.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria columnaris] AJF42754.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria humboldtensis] AJF42834.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria biramulata] AJF42910.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria subulata] AJF42998.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria columnaris] AJF43080.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria biramulata] AJF43162.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria muelleri] AJF43241.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria subulata] AJF43323.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria montana] AJF43405.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria montana] AJF43487.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria laubenfelsii] AJF43568.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria schmidii] AJF43651.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria rulei] AJF43729.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria nemorosa] AJF43811.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria humboldtensis] AJF43890.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria bernieri] AJF43973.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria nemorosa] AJF44055.1 ATP synthase CF1 epsilon chain (chloroplast) [Araucaria laubenfelsii] Length = 136 Score = 89.7 bits (221), Expect = 2e-21 Identities = 46/70 (65%), Positives = 56/70 (80%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ NQI + VN+AE+G+DID QEAQE F+ AKA+ R GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNQITVLVNNAERGIDIDFQEAQESFRIAKADLARAQGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVLPN 15 LEAI A+ PN Sbjct: 126 LEAIGALSPN 135 >KYP58869.1 hypothetical protein KK1_014291 [Cajanus cajan] Length = 75 Score = 87.8 bits (216), Expect = 2e-21 Identities = 42/67 (62%), Positives = 54/67 (80%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FA+I N+I + VNDAEKG DIDPQEAQ+ + A+AN N+ GKRQKIE +LA++RARTR Sbjct: 8 FARINNNEITVLVNDAEKGSDIDPQEAQQTLKIAEANLNKAEGKRQKIEANLALRRARTR 67 Query: 44 LEAINAV 24 +EAIN + Sbjct: 68 VEAINVI 74 >YP_001312208.1 ATP synthase CF1 epsilon chain [Cycas taitungensis] YP_007474649.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cycas revoluta] YP_009308219.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cycas panzhihuaensis] BAF64949.1 ATP synthase CF1 epsilon chain (chloroplast) [Cycas taitungensis] ABU85272.1 ATP synthase CF1 epsilon subunit, partial (chloroplast) [Cycas micronesica] AEX99198.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cycas revoluta] AOS53168.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cycas panzhihuaensis] Length = 138 Score = 89.0 bits (219), Expect = 5e-21 Identities = 43/73 (58%), Positives = 61/73 (83%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FA+I+ N+I + VNDAEKG+DIDP+EA+E F+ A+A+ R GKRQ IE ++A++RARTR Sbjct: 66 FARIDNNKITILVNDAEKGIDIDPREARETFRIAEADLARAEGKRQVIEANVALRRARTR 125 Query: 44 LEAINAVLPN*SS 6 LEAI+A+LP+ S+ Sbjct: 126 LEAISAILPSVSN 138 >YP_009154358.1 ATP synthase CF1 epsilon subunit (chloroplast) [Metasequoia glyptostroboides] AKM70816.1 ATP synthase CF1 epsilon subunit (chloroplast) [Metasequoia glyptostroboides] Length = 135 Score = 88.6 bits (218), Expect = 6e-21 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+I L VN+AE+G+DID QEAQE+F+ AKA+ R GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNEITLLVNNAERGIDIDLQEAQEIFRLAKADRARAEGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVL 21 LEA +A+L Sbjct: 126 LEAADAIL 133 >XP_013459392.1 ATP synthase, delta/epsilon chain, long alpha-helix protein [Medicago truncatula] KEH33423.1 ATP synthase, delta/epsilon chain, long alpha-helix protein [Medicago truncatula] Length = 74 Score = 86.7 bits (213), Expect = 7e-21 Identities = 41/67 (61%), Positives = 54/67 (80%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FA+I N+I + VNDAEK +DIDPQEAQ+ + A+AN N+ GKRQKIE +LA++RARTR Sbjct: 7 FARIGNNEITILVNDAEKSIDIDPQEAQQTLKIAEANLNKAEGKRQKIEANLALRRARTR 66 Query: 44 LEAINAV 24 +EAIN + Sbjct: 67 VEAINRI 73 >YP_009259097.1 ATP synthase CF1 epsilon subunit (chloroplast) [Sequoia sempervirens] ALB37003.1 ATP synthase CF1 epsilon subunit (chloroplast) [Sequoia sempervirens] Length = 135 Score = 88.2 bits (217), Expect = 9e-21 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = -3 Query: 224 FAKIEQNQIILWVNDAEKGVDIDPQEAQEVFQQAKANANRVLGKRQKIEVDLAIKRARTR 45 FAKI+ N+I L VN+AE+G+DID QEAQE F+ AKA+ R GKRQ IE D+A+KRARTR Sbjct: 66 FAKIDNNEITLLVNNAERGIDIDLQEAQESFRLAKADRARAEGKRQAIEADVALKRARTR 125 Query: 44 LEAINAVL 21 LEA++A+L Sbjct: 126 LEAVDAIL 133