BLASTX nr result
ID: Ephedra29_contig00017321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00017321 (202 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009393867.1 PREDICTED: dihydrolipoyllysine-residue succinyltr... 53 2e-06 XP_012828752.1 PREDICTED: dihydrolipoyllysine-residue succinyltr... 52 4e-06 XP_012828750.1 PREDICTED: dihydrolipoyllysine-residue succinyltr... 52 4e-06 >XP_009393867.1 PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 452 Score = 52.8 bits (125), Expect = 2e-06 Identities = 34/55 (61%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = +1 Query: 1 YMGESVTNGTLDTFLKKTR-R*N*SR*--GYSTDKVTIDVNILEAGIIWEFMAKE 156 YMGES+T+GTL TFLKK R N TDKVTIDVN E GII EF+AKE Sbjct: 78 YMGESITDGTLATFLKKPGDRVNVDEPIAQVETDKVTIDVNSPETGIIQEFIAKE 132 >XP_012828752.1 PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like isoform X2 [Erythranthe guttata] Length = 470 Score = 52.0 bits (123), Expect = 4e-06 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = +1 Query: 1 YMGESVTNGTLDTFLKKTR---R*N*SR*GYSTDKVTIDVNILEAGIIWEFMAKE 156 YMGES+T+GTL FLKK + + TDKVTIDVN EAG+I EF+AKE Sbjct: 103 YMGESITDGTLAVFLKKVGDRVEVDEAIAQVETDKVTIDVNSPEAGVIQEFIAKE 157 >XP_012828750.1 PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like isoform X1 [Erythranthe guttata] XP_012828751.1 PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like isoform X1 [Erythranthe guttata] EYU18214.1 hypothetical protein MIMGU_mgv1a005716mg [Erythranthe guttata] EYU18215.1 hypothetical protein MIMGU_mgv1a005716mg [Erythranthe guttata] Length = 473 Score = 52.0 bits (123), Expect = 4e-06 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = +1 Query: 1 YMGESVTNGTLDTFLKKTR---R*N*SR*GYSTDKVTIDVNILEAGIIWEFMAKE 156 YMGES+T+GTL FLKK + + TDKVTIDVN EAG+I EF+AKE Sbjct: 106 YMGESITDGTLAVFLKKVGDRVEVDEAIAQVETDKVTIDVNSPEAGVIQEFIAKE 160