BLASTX nr result
ID: Ephedra29_contig00017300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00017300 (747 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNA20732.1 hypothetical protein SOVF_049650 [Spinacia oleracea] 58 4e-06 >KNA20732.1 hypothetical protein SOVF_049650 [Spinacia oleracea] Length = 633 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -2 Query: 725 FIKDGWSSFVNDNSLQCGDILVFRCLSESHYLVQIFSFDGDEKERASY 582 + +DGWS+FVND+SLQCGD L+FR +S++ +QIF EK+ A Y Sbjct: 62 YFRDGWSTFVNDHSLQCGDTLIFRYNWDSNFNIQIFDQSSCEKDEAFY 109