BLASTX nr result
ID: Ephedra29_contig00016947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016947 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019158108.1 PREDICTED: disease resistance protein TAO1-like [... 76 4e-14 XP_010551473.1 PREDICTED: TMV resistance protein N-like isoform ... 76 5e-14 XP_010551472.1 PREDICTED: TMV resistance protein N-like isoform ... 76 5e-14 XP_019158109.1 PREDICTED: TMV resistance protein N-like [Ipomoea... 74 2e-13 XP_017970757.1 PREDICTED: disease resistance protein TAO1 isofor... 73 6e-13 EOY00265.1 Tir-nbs-lrr resistance protein, putative isoform 4 [T... 73 6e-13 EOY00263.1 Tir-nbs-lrr resistance protein, putative isoform 2 [T... 73 6e-13 EOY00264.1 Tir-nbs-lrr resistance protein, putative isoform 3 [T... 73 6e-13 XP_007044430.2 PREDICTED: disease resistance protein TAO1 isofor... 73 6e-13 EOY00262.1 Tir-nbs-lrr resistance protein, putative isoform 1 [T... 73 6e-13 XP_017226497.1 PREDICTED: TMV resistance protein N [Daucus carot... 72 1e-12 XP_006438531.1 hypothetical protein CICLE_v10030550mg [Citrus cl... 72 1e-12 XP_010251790.1 PREDICTED: LOW QUALITY PROTEIN: disease resistanc... 72 2e-12 KDO82675.1 hypothetical protein CISIN_1g000630mg [Citrus sinensis] 72 2e-12 XP_006483293.1 PREDICTED: disease resistance protein TAO1-like [... 72 2e-12 KCW85844.1 hypothetical protein EUGRSUZ_B02581 [Eucalyptus grandis] 71 2e-12 XP_010043844.1 PREDICTED: disease resistance protein TAO1 [Eucal... 71 2e-12 OAY49926.1 hypothetical protein MANES_05G094300 [Manihot esculenta] 70 7e-12 KFK25453.1 hypothetical protein AALP_AA8G117100 [Arabis alpina] 70 7e-12 JAU40593.1 TMV resistance protein N, partial [Noccaea caerulescens] 70 7e-12 >XP_019158108.1 PREDICTED: disease resistance protein TAO1-like [Ipomoea nil] Length = 1373 Score = 76.3 bits (186), Expect = 4e-14 Identities = 39/86 (45%), Positives = 51/86 (59%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L KL L DC EL+ LP LP+SLT++ + NC L IS LS + L+ LR Sbjct: 1105 LPSSTKGLTVLKKLLLPDCKELKSLPPLPSSLTDLNVANCSSLEHISDLSNLGSLRELRF 1164 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC+++ +P S SL+ L VGC Sbjct: 1165 SNCKKITDIPGLESLKSLRWLYTVGC 1190 >XP_010551473.1 PREDICTED: TMV resistance protein N-like isoform X2 [Tarenaya hassleriana] Length = 1371 Score = 75.9 bits (185), Expect = 5e-14 Identities = 35/86 (40%), Positives = 50/86 (58%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L +L LYDC EL LPCLP+SL ++ + NC L I +S ++ L L + Sbjct: 1095 LPSSLKGLSNLRELLLYDCQELRSLPCLPSSLEKLDLTNCFSLERIDDISNLELLHYLSL 1154 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC+R+V +P +L+ L + GC Sbjct: 1155 TNCQRVVDIPGLERLKALKRLYLAGC 1180 >XP_010551472.1 PREDICTED: TMV resistance protein N-like isoform X1 [Tarenaya hassleriana] Length = 1374 Score = 75.9 bits (185), Expect = 5e-14 Identities = 35/86 (40%), Positives = 50/86 (58%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L +L LYDC EL LPCLP+SL ++ + NC L I +S ++ L L + Sbjct: 1098 LPSSLKGLSNLRELLLYDCQELRSLPCLPSSLEKLDLTNCFSLERIDDISNLELLHYLSL 1157 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC+R+V +P +L+ L + GC Sbjct: 1158 TNCQRVVDIPGLERLKALKRLYLAGC 1183 >XP_019158109.1 PREDICTED: TMV resistance protein N-like [Ipomoea nil] Length = 1365 Score = 73.9 bits (180), Expect = 2e-13 Identities = 38/86 (44%), Positives = 49/86 (56%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L KL L DC EL+ LP LP+SL E+ + NC L IS LS + L+ LR Sbjct: 1097 LPSSMKGLTVLKKLFLPDCKELKSLPPLPSSLAELNVANCSSLEHISDLSNLGSLQELRF 1156 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC+++ +P S SL+ L GC Sbjct: 1157 SNCKKITDIPGLESLKSLRRLYTGGC 1182 >XP_017970757.1 PREDICTED: disease resistance protein TAO1 isoform X2 [Theobroma cacao] Length = 1161 Score = 72.8 bits (177), Expect = 6e-13 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -1 Query: 269 SYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRL 90 S LP S L L KL L C LE LP LP+SL E+ + NC+ L IS LS ++ L+ L Sbjct: 1056 SKLPSSLRGLSLLKKLRLSQCENLESLPPLPSSLEELNLANCISLESISDLSNLKSLEEL 1115 Query: 89 RIHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P S SL++L + C Sbjct: 1116 NLTNCEKLVDIPGLESLKSLRKLYMGNC 1143 >EOY00265.1 Tir-nbs-lrr resistance protein, putative isoform 4 [Theobroma cacao] Length = 1167 Score = 72.8 bits (177), Expect = 6e-13 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -1 Query: 269 SYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRL 90 S LP S L L KL L C LE LP LP+SL E+ + NC+ L IS LS ++ L+ L Sbjct: 1056 SKLPSSLRGLSLLKKLRLSQCENLESLPPLPSSLEELNLANCISLESISDLSNLKSLEEL 1115 Query: 89 RIHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P S SL++L + C Sbjct: 1116 NLTNCEKLVDIPGLESLKSLRKLYMGNC 1143 >EOY00263.1 Tir-nbs-lrr resistance protein, putative isoform 2 [Theobroma cacao] Length = 1172 Score = 72.8 bits (177), Expect = 6e-13 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -1 Query: 269 SYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRL 90 S LP S L L KL L C LE LP LP+SL E+ + NC+ L IS LS ++ L+ L Sbjct: 1056 SKLPSSLRGLSLLKKLRLSQCENLESLPPLPSSLEELNLANCISLESISDLSNLKSLEEL 1115 Query: 89 RIHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P S SL++L + C Sbjct: 1116 NLTNCEKLVDIPGLESLKSLRKLYMGNC 1143 >EOY00264.1 Tir-nbs-lrr resistance protein, putative isoform 3 [Theobroma cacao] Length = 1353 Score = 72.8 bits (177), Expect = 6e-13 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -1 Query: 269 SYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRL 90 S LP S L L KL L C LE LP LP+SL E+ + NC+ L IS LS ++ L+ L Sbjct: 1056 SKLPSSLRGLSLLKKLRLSQCENLESLPPLPSSLEELNLANCISLESISDLSNLKSLEEL 1115 Query: 89 RIHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P S SL++L + C Sbjct: 1116 NLTNCEKLVDIPGLESLKSLRKLYMGNC 1143 >XP_007044430.2 PREDICTED: disease resistance protein TAO1 isoform X1 [Theobroma cacao] Length = 1382 Score = 72.8 bits (177), Expect = 6e-13 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -1 Query: 269 SYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRL 90 S LP S L L KL L C LE LP LP+SL E+ + NC+ L IS LS ++ L+ L Sbjct: 1056 SKLPSSLRGLSLLKKLRLSQCENLESLPPLPSSLEELNLANCISLESISDLSNLKSLEEL 1115 Query: 89 RIHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P S SL++L + C Sbjct: 1116 NLTNCEKLVDIPGLESLKSLRKLYMGNC 1143 >EOY00262.1 Tir-nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] Length = 1382 Score = 72.8 bits (177), Expect = 6e-13 Identities = 38/88 (43%), Positives = 51/88 (57%) Frame = -1 Query: 269 SYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRL 90 S LP S L L KL L C LE LP LP+SL E+ + NC+ L IS LS ++ L+ L Sbjct: 1056 SKLPSSLRGLSLLKKLRLSQCENLESLPPLPSSLEELNLANCISLESISDLSNLKSLEEL 1115 Query: 89 RIHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P S SL++L + C Sbjct: 1116 NLTNCEKLVDIPGLESLKSLRKLYMGNC 1143 >XP_017226497.1 PREDICTED: TMV resistance protein N [Daucus carota subsp. sativus] Length = 1427 Score = 72.0 bits (175), Expect = 1e-12 Identities = 38/87 (43%), Positives = 49/87 (56%) Frame = -1 Query: 266 YLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLR 87 +LP S L L KL L C L LP LP+SLTE+ NC+ L IS LS ++ L+ L Sbjct: 1107 HLPSSLRELHFLEKLDLAHCKRLRVLPPLPSSLTELNAANCIALETISDLSELEHLEELH 1166 Query: 86 IHNCRRLVGLPDFSSFLSLQELSIVGC 6 + NC +LV +P F SL L + GC Sbjct: 1167 LSNCEKLVDIPGFECLKSLTRLHMCGC 1193 >XP_006438531.1 hypothetical protein CICLE_v10030550mg [Citrus clementina] ESR51771.1 hypothetical protein CICLE_v10030550mg [Citrus clementina] Length = 1175 Score = 71.6 bits (174), Expect = 1e-12 Identities = 38/86 (44%), Positives = 48/86 (55%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L L L C EL+ LP LP+SL EV + NC L I LS ++ LKRL + Sbjct: 1045 LPSSLRGLSHLKNLLLPYCQELKSLPPLPSSLEEVNVANCFALESICDLSNLKSLKRLNL 1104 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC +LV + S SL+ L + GC Sbjct: 1105 TNCEKLVDISGLESLKSLKWLYMSGC 1130 >XP_010251790.1 PREDICTED: LOW QUALITY PROTEIN: disease resistance protein TAO1-like [Nelumbo nucifera] Length = 1382 Score = 71.6 bits (174), Expect = 2e-12 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L KL L +EL+ LP LP+SLT+V + NC L IS LS ++ L+ L + Sbjct: 1104 LPSSLRGLSVLRKLTLSHSVELKSLPPLPSSLTDVNVANCTALESISDLSNLKNLEHLDL 1163 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC +++ +P S SL+ L + GC Sbjct: 1164 TNCNKVIDIPGLESLNSLKRLYMTGC 1189 >KDO82675.1 hypothetical protein CISIN_1g000630mg [Citrus sinensis] Length = 1382 Score = 71.6 bits (174), Expect = 2e-12 Identities = 38/86 (44%), Positives = 48/86 (55%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L L L C EL+ LP LP+SL EV + NC L I LS ++ LKRL + Sbjct: 1099 LPSSLRGLSHLKNLLLPYCQELKSLPPLPSSLEEVNVANCFALESICDLSNLKSLKRLNL 1158 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC +LV + S SL+ L + GC Sbjct: 1159 TNCEKLVDISGLESLKSLKWLYMSGC 1184 >XP_006483293.1 PREDICTED: disease resistance protein TAO1-like [Citrus sinensis] Length = 1382 Score = 71.6 bits (174), Expect = 2e-12 Identities = 38/86 (44%), Positives = 48/86 (55%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L L L C EL+ LP LP+SL EV + NC L I LS ++ LKRL + Sbjct: 1099 LPSSLRGLSHLKNLLLPYCQELKSLPPLPSSLEEVNVANCFALESICDLSNLKSLKRLNL 1158 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC +LV + S SL+ L + GC Sbjct: 1159 TNCEKLVDISGLESLKSLKWLYMSGC 1184 >KCW85844.1 hypothetical protein EUGRSUZ_B02581 [Eucalyptus grandis] Length = 829 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/86 (41%), Positives = 50/86 (58%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L KL L C EL+ LP LP+SL EV I C+ + IS LS ++ L+ L + Sbjct: 561 LPTSLKGLSVLQKLLLPHCKELKSLPPLPSSLVEVNIAGCVAIETISDLSELENLQELNM 620 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC ++V +P SL+ L ++GC Sbjct: 621 ANCEKVVDVPGLQRLKSLRRLYMIGC 646 >XP_010043844.1 PREDICTED: disease resistance protein TAO1 [Eucalyptus grandis] XP_018724437.1 PREDICTED: disease resistance protein TAO1 [Eucalyptus grandis] XP_018724438.1 PREDICTED: disease resistance protein TAO1 [Eucalyptus grandis] Length = 1379 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/86 (41%), Positives = 50/86 (58%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L KL L C EL+ LP LP+SL EV I C+ + IS LS ++ L+ L + Sbjct: 1111 LPTSLKGLSVLQKLLLPHCKELKSLPPLPSSLVEVNIAGCVAIETISDLSELENLQELNM 1170 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC ++V +P SL+ L ++GC Sbjct: 1171 ANCEKVVDVPGLQRLKSLRRLYMIGC 1196 >OAY49926.1 hypothetical protein MANES_05G094300 [Manihot esculenta] Length = 1373 Score = 69.7 bits (169), Expect = 7e-12 Identities = 37/90 (41%), Positives = 49/90 (54%) Frame = -1 Query: 275 KCSYLPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLK 96 K LP S L L LCL C +L LP LP+SL E+ I NC+ L IS S ++ LK Sbjct: 1094 KFDSLPSSLQGLSLLKNLCLKHCEKLISLPPLPSSLEELDISNCIALRIISDTSNLESLK 1153 Query: 95 RLRIHNCRRLVGLPDFSSFLSLQELSIVGC 6 +L + NC ++ +P F SL L + GC Sbjct: 1154 QLNLTNCDEVLDIPGFECMKSLVRLYMSGC 1183 >KFK25453.1 hypothetical protein AALP_AA8G117100 [Arabis alpina] Length = 1373 Score = 69.7 bits (169), Expect = 7e-12 Identities = 35/86 (40%), Positives = 47/86 (54%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L +L LYDC ELE LP LP L ++ + NC L IS LS ++ L L + Sbjct: 1100 LPASLEGLSNLRELSLYDCRELECLPPLPWKLEQLNLGNCFALESISDLSKLENLHELNL 1159 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC ++ +P SL+ L + GC Sbjct: 1160 TNCEKVADIPGLEHLTSLKRLYMSGC 1185 >JAU40593.1 TMV resistance protein N, partial [Noccaea caerulescens] Length = 1415 Score = 69.7 bits (169), Expect = 7e-12 Identities = 35/86 (40%), Positives = 47/86 (54%) Frame = -1 Query: 263 LPESFSALPRLYKLCLYDCMELEELPCLPNSLTEVRIQNCLGLNDISRLSGMQKLKRLRI 84 LP S L L +L LYDC EL LP LP L ++ + NC L IS LS ++ L L + Sbjct: 1144 LPASLRGLTNLRELSLYDCQELMSLPPLPCKLEKLNLANCFSLESISDLSNLEILHDLNL 1203 Query: 83 HNCRRLVGLPDFSSFLSLQELSIVGC 6 NC ++V +P +LQ L + GC Sbjct: 1204 TNCEKVVDIPGLEHLTALQRLYMSGC 1229