BLASTX nr result
ID: Ephedra29_contig00016851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016851 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012449050.1 PREDICTED: laccase-12-like [Gossypium raimondii] 52 1e-06 KJB67512.1 hypothetical protein B456_010G194400 [Gossypium raimo... 52 5e-06 >XP_012449050.1 PREDICTED: laccase-12-like [Gossypium raimondii] Length = 143 Score = 52.4 bits (124), Expect = 1e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +1 Query: 109 VFLVSFLALWTVMVAAEVQKHVFVLGSTRVTRLCKTQNVITVNG 240 +FLV FLAL AEVQ+H FV+ +T+V RLCKT N+ITVNG Sbjct: 10 IFLVIFLAL---SANAEVQRHRFVIQATKVKRLCKTHNIITVNG 50 >KJB67512.1 hypothetical protein B456_010G194400 [Gossypium raimondii] Length = 353 Score = 52.4 bits (124), Expect = 5e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +1 Query: 109 VFLVSFLALWTVMVAAEVQKHVFVLGSTRVTRLCKTQNVITVNG 240 +FLV FLAL AEVQ+H FV+ +T+V RLCKT N+ITVNG Sbjct: 10 IFLVIFLAL---SANAEVQRHRFVIQATKVKRLCKTHNIITVNG 50