BLASTX nr result
ID: Ephedra29_contig00016465
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016465 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002975512.1 hypothetical protein SELMODRAFT_103907 [Selaginel... 109 1e-27 AEW09099.1 hypothetical protein CL3803Contig1_04, partial [Pinus... 99 2e-25 XP_001752458.1 predicted protein [Physcomitrella patens] EDQ8269... 100 1e-24 XP_001770762.1 predicted protein [Physcomitrella patens] EDQ6444... 101 3e-24 OAE24553.1 hypothetical protein AXG93_2415s1320 [Marchantia poly... 100 3e-23 XP_001764877.1 predicted protein [Physcomitrella patens] EDQ7031... 97 1e-22 XP_001752164.1 predicted protein [Physcomitrella patens] EDQ8289... 95 6e-22 XP_006844713.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 96 1e-21 XP_010249378.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 94 9e-21 XP_010249377.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 94 1e-20 XP_008797654.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 92 1e-20 JAT51441.1 Baculoviral IAP repeat-containing protein 8, partial ... 89 2e-20 XP_006840685.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 91 1e-19 XP_010263518.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 90 2e-19 XP_008782230.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 90 2e-19 XP_008811838.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 90 2e-19 XP_008811837.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 90 2e-19 XP_008811836.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 90 2e-19 XP_010926405.2 PREDICTED: probable BOI-related E3 ubiquitin-prot... 90 2e-19 XP_010942314.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 89 1e-18 >XP_002975512.1 hypothetical protein SELMODRAFT_103907 [Selaginella moellendorffii] XP_002993531.1 hypothetical protein SELMODRAFT_137185 [Selaginella moellendorffii] EFJ05423.1 hypothetical protein SELMODRAFT_137185 [Selaginella moellendorffii] EFJ23141.1 hypothetical protein SELMODRAFT_103907 [Selaginella moellendorffii] Length = 246 Score = 109 bits (273), Expect = 1e-27 Identities = 44/64 (68%), Positives = 57/64 (89%) Frame = -1 Query: 291 HAKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQ 112 HA+T KENK+ + +R+C+VCR N+VCILLLPCRHLCLCKECE+R++TCP+C KNASVQ Sbjct: 183 HARTYKENKELREKRTCRVCRSNDVCILLLPCRHLCLCKECEARLDTCPLCRHSKNASVQ 242 Query: 111 IYMA 100 +YM+ Sbjct: 243 VYMS 246 >AEW09099.1 hypothetical protein CL3803Contig1_04, partial [Pinus radiata] AFG55653.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55654.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55655.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55656.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55657.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55658.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55659.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55660.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55661.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55662.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55663.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55664.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55665.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55666.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55667.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55668.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55669.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] AFG55670.1 hypothetical protein CL3803Contig1_04, partial [Pinus taeda] Length = 59 Score = 98.6 bits (244), Expect = 2e-25 Identities = 39/59 (66%), Positives = 50/59 (84%) Frame = -1 Query: 276 KENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYMA 100 +EN++ K QR+C+VCR N CILLLPCRHLCLCK+CE R+ CP+C+S KNASVQ+YM+ Sbjct: 1 RENRELKEQRTCRVCRTNMSCILLLPCRHLCLCKDCEGRLEKCPLCNSAKNASVQVYMS 59 >XP_001752458.1 predicted protein [Physcomitrella patens] EDQ82697.1 predicted protein, partial [Physcomitrella patens] Length = 206 Score = 100 bits (250), Expect = 1e-24 Identities = 39/63 (61%), Positives = 55/63 (87%) Frame = -1 Query: 291 HAKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQ 112 HA+T +EN++ + QR+C+ CR N+V ILLLPCRHLCLCK+CE+R++ CP+C ++KNASVQ Sbjct: 144 HARTYRENRELREQRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDACPLCQTLKNASVQ 203 Query: 111 IYM 103 +YM Sbjct: 204 VYM 206 >XP_001770762.1 predicted protein [Physcomitrella patens] EDQ64444.1 predicted protein [Physcomitrella patens] Length = 268 Score = 101 bits (252), Expect = 3e-24 Identities = 39/64 (60%), Positives = 56/64 (87%) Frame = -1 Query: 291 HAKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQ 112 HA+T +EN++ + QR+C+ CR N+V ILLLPCRHLCLCK+CE+R++ CP+C ++KNASVQ Sbjct: 205 HARTFRENRELREQRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDVCPLCQTLKNASVQ 264 Query: 111 IYMA 100 +YM+ Sbjct: 265 VYMS 268 >OAE24553.1 hypothetical protein AXG93_2415s1320 [Marchantia polymorpha subsp. polymorpha] Length = 374 Score = 100 bits (250), Expect = 3e-23 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -1 Query: 288 AKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQI 109 A+ +ENK+ K QR+C+VCR N+V ILLLPCRHLCLCK+CE R TCP+C S KNASVQ+ Sbjct: 312 ARAFRENKELKEQRTCRVCRCNDVSILLLPCRHLCLCKDCEGRSTTCPLCQSPKNASVQV 371 Query: 108 YMA 100 YM+ Sbjct: 372 YMS 374 >XP_001764877.1 predicted protein [Physcomitrella patens] EDQ70319.1 predicted protein, partial [Physcomitrella patens] Length = 245 Score = 97.1 bits (240), Expect = 1e-22 Identities = 37/63 (58%), Positives = 52/63 (82%) Frame = -1 Query: 291 HAKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQ 112 H +T ENK+ + QR+C+VCR N+V +LLLPCRHLCLC++CE +++ CP+C + KNASVQ Sbjct: 183 HTRTFNENKELREQRTCRVCRCNDVSVLLLPCRHLCLCQDCEGQLHACPLCRTPKNASVQ 242 Query: 111 IYM 103 +YM Sbjct: 243 VYM 245 >XP_001752164.1 predicted protein [Physcomitrella patens] EDQ82897.1 predicted protein, partial [Physcomitrella patens] Length = 246 Score = 95.1 bits (235), Expect = 6e-22 Identities = 36/64 (56%), Positives = 53/64 (82%) Frame = -1 Query: 291 HAKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQ 112 H +T ENK+ + QR+C+VCR N+V +LLLPCRHLCLC++CE +++ CP+C + KNASVQ Sbjct: 183 HTRTFNENKELREQRTCRVCRCNDVSMLLLPCRHLCLCQDCEGQLHACPLCRTPKNASVQ 242 Query: 111 IYMA 100 ++M+ Sbjct: 243 VFMS 246 >XP_006844713.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 [Amborella trichopoda] ERN06388.1 hypothetical protein AMTR_s00016p00251370 [Amborella trichopoda] Length = 354 Score = 95.9 bits (237), Expect = 1e-21 Identities = 37/62 (59%), Positives = 54/62 (87%) Frame = -1 Query: 288 AKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQI 109 A+ KEN++ K +R+CK+CR++E+ ILLLPCRHLCLCK+CES+ + CP+C+S KNAS+QI Sbjct: 293 ARAFKENQELKHRRTCKICRKSEISILLLPCRHLCLCKDCESKFDVCPLCNSRKNASLQI 352 Query: 108 YM 103 ++ Sbjct: 353 HL 354 >XP_010249378.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X2 [Nelumbo nucifera] Length = 342 Score = 93.6 bits (231), Expect = 9e-21 Identities = 37/62 (59%), Positives = 51/62 (82%) Frame = -1 Query: 285 KTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIY 106 K +KEN++ K + CKVCR EV +LLLPCRHLC+CK CESR++ CP+C+S+KNA++QI Sbjct: 281 KDIKENRELKSRTRCKVCREKEVSVLLLPCRHLCVCKVCESRLSICPVCNSIKNATLQIV 340 Query: 105 MA 100 M+ Sbjct: 341 MS 342 >XP_010249377.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X1 [Nelumbo nucifera] Length = 343 Score = 93.6 bits (231), Expect = 1e-20 Identities = 37/62 (59%), Positives = 51/62 (82%) Frame = -1 Query: 285 KTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIY 106 K +KEN++ K + CKVCR EV +LLLPCRHLC+CK CESR++ CP+C+S+KNA++QI Sbjct: 282 KDIKENRELKSRTRCKVCREKEVSVLLLPCRHLCVCKVCESRLSICPVCNSIKNATLQIV 341 Query: 105 MA 100 M+ Sbjct: 342 MS 343 >XP_008797654.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Phoenix dactylifera] Length = 294 Score = 92.4 bits (228), Expect = 1e-20 Identities = 36/62 (58%), Positives = 50/62 (80%) Frame = -1 Query: 288 AKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQI 109 A +EN++ +++R CK CR +VC+LLLPCRHLCLC CE +I+TCPIC SVKNAS++I Sbjct: 232 ATAARENEELRLRRGCKACRDKDVCVLLLPCRHLCLCVACEPKIDTCPICHSVKNASLEI 291 Query: 108 YM 103 ++ Sbjct: 292 FL 293 >JAT51441.1 Baculoviral IAP repeat-containing protein 8, partial [Anthurium amnicola] Length = 141 Score = 88.6 bits (218), Expect = 2e-20 Identities = 33/56 (58%), Positives = 49/56 (87%) Frame = -1 Query: 267 KQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYMA 100 ++ + +R+CKVC EV +LLLPCRHLCLCK+CE+R++ CP+C++VKNAS+QI+M+ Sbjct: 86 RELRRRRACKVCMEREVSVLLLPCRHLCLCKQCEARLDACPVCNAVKNASLQIFMS 141 >XP_006840685.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Amborella trichopoda] ERN02360.1 hypothetical protein AMTR_s00096p00060800 [Amborella trichopoda] Length = 336 Score = 90.5 bits (223), Expect = 1e-19 Identities = 35/62 (56%), Positives = 51/62 (82%) Frame = -1 Query: 285 KTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIY 106 +TL EN++ K QR+C+VC+ EV +LLLPCRHLCLCK+CE ++ CP+C ++K ASVQ++ Sbjct: 275 RTLLENRELKGQRTCRVCKNKEVSMLLLPCRHLCLCKDCEGFLDVCPVCRTLKTASVQVF 334 Query: 105 MA 100 M+ Sbjct: 335 MS 336 >XP_010263518.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Nelumbo nucifera] Length = 334 Score = 90.1 bits (222), Expect = 2e-19 Identities = 37/58 (63%), Positives = 46/58 (79%) Frame = -1 Query: 276 KENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYM 103 KENK K +CKVCR NEVC+LLLPCRHLCLCKECES+++ CP+C S K +++YM Sbjct: 277 KENKDLKELMTCKVCRVNEVCMLLLPCRHLCLCKECESKLSFCPLCQSSKFIGMEVYM 334 >XP_008782230.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Phoenix dactylifera] Length = 322 Score = 89.7 bits (221), Expect = 2e-19 Identities = 36/58 (62%), Positives = 45/58 (77%) Frame = -1 Query: 276 KENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYM 103 KENK K +CK+C+ NE C+LLLPCRHLCLCKECESR++ CP+C S K ++IYM Sbjct: 265 KENKDLKESMACKICKGNEACMLLLPCRHLCLCKECESRLSFCPLCQSSKLLGMEIYM 322 >XP_008811838.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 isoform X3 [Phoenix dactylifera] Length = 324 Score = 89.7 bits (221), Expect = 2e-19 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = -1 Query: 276 KENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYM 103 KENK+ K +CK+C+ NE C+LLLPCRHLCLCKECES+++ CP+C S K ++IYM Sbjct: 267 KENKEMKDSMACKICKHNEACMLLLPCRHLCLCKECESKLSFCPLCQSSKFIGMEIYM 324 >XP_008811837.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 isoform X2 [Phoenix dactylifera] Length = 325 Score = 89.7 bits (221), Expect = 2e-19 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = -1 Query: 276 KENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYM 103 KENK+ K +CK+C+ NE C+LLLPCRHLCLCKECES+++ CP+C S K ++IYM Sbjct: 268 KENKEMKDSMACKICKHNEACMLLLPCRHLCLCKECESKLSFCPLCQSSKFIGMEIYM 325 >XP_008811836.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 isoform X1 [Phoenix dactylifera] Length = 326 Score = 89.7 bits (221), Expect = 2e-19 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = -1 Query: 276 KENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYM 103 KENK+ K +CK+C+ NE C+LLLPCRHLCLCKECES+++ CP+C S K ++IYM Sbjct: 269 KENKEMKDSMACKICKHNEACMLLLPCRHLCLCKECESKLSFCPLCQSSKFIGMEIYM 326 >XP_010926405.2 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Elaeis guineensis] Length = 332 Score = 89.7 bits (221), Expect = 2e-19 Identities = 36/60 (60%), Positives = 46/60 (76%) Frame = -1 Query: 282 TLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQIYM 103 T KENK K +CK+CR NE C+LLLPCRHLCLCKECE++++ CP+C S K ++IYM Sbjct: 273 TCKENKNLKESMACKICRVNEACMLLLPCRHLCLCKECENKLSFCPLCQSSKFIGMEIYM 332 >XP_010942314.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X2 [Elaeis guineensis] Length = 383 Score = 88.6 bits (218), Expect = 1e-18 Identities = 33/63 (52%), Positives = 50/63 (79%) Frame = -1 Query: 288 AKTLKENKQFKMQRSCKVCRRNEVCILLLPCRHLCLCKECESRINTCPICSSVKNASVQI 109 A L++N++ +R+CK+C+ +VC+LL PCRHLCLCK+CE ++TCPIC SVK+ +QI Sbjct: 321 AAALRQNEELLWRRACKICQEKDVCVLLFPCRHLCLCKDCEPMVDTCPICQSVKSDFLQI 380 Query: 108 YMA 100 +M+ Sbjct: 381 FMS 383