BLASTX nr result
ID: Ephedra29_contig00016256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016256 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE33494.1 hypothetical protein AXG93_3822s1520 [Marchantia poly... 74 4e-13 XP_001772776.1 predicted protein [Physcomitrella patens] EDQ6234... 74 6e-13 XP_001786248.1 predicted protein [Physcomitrella patens] EDQ4894... 72 2e-12 XP_002970115.1 hypothetical protein SELMODRAFT_92558 [Selaginell... 72 2e-12 XP_002985305.1 hypothetical protein SELMODRAFT_121884 [Selaginel... 72 2e-12 AEW07744.1 hypothetical protein 0_10449_01, partial [Pinus radia... 63 4e-11 XP_008451069.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 67 2e-10 XP_004144149.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 67 2e-10 OAY57924.1 hypothetical protein MANES_02G135500 [Manihot esculenta] 65 5e-10 XP_011036379.1 PREDICTED: F-box/kelch-repeat protein At5g26960-l... 65 1e-09 XP_002313276.2 hypothetical protein POPTR_0009s07090g [Populus t... 65 1e-09 XP_012076012.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 64 1e-09 XP_002523232.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 64 2e-09 XP_010673803.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 64 2e-09 XP_011025021.1 PREDICTED: F-box/kelch-repeat protein At5g26960-l... 64 2e-09 XP_002299964.1 hypothetical protein POPTR_0001s27880g [Populus t... 63 5e-09 XP_002268943.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 62 6e-09 XP_017627448.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 62 6e-09 XP_016743967.1 PREDICTED: F-box/kelch-repeat protein At5g26960-l... 62 6e-09 XP_012478079.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [... 62 6e-09 >OAE33494.1 hypothetical protein AXG93_3822s1520 [Marchantia polymorpha subsp. polymorpha] Length = 486 Score = 74.3 bits (181), Expect = 4e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R RGLKEGLVLIYDT +EW RGP LP+++NGA CAVV C Sbjct: 439 DLLRRSGRHGRGLKEGLVLIYDTISEEWSRGPDLPYVKNGATCAVVLC 486 >XP_001772776.1 predicted protein [Physcomitrella patens] EDQ62343.1 predicted protein [Physcomitrella patens] Length = 436 Score = 73.9 bits (180), Expect = 6e-13 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R+ RG KE LVLIYDT+ QEW RGP LP+++NGA C VV+C Sbjct: 389 DLLRRSGRNGRGYKERLVLIYDTRTQEWSRGPDLPYVKNGATCTVVQC 436 >XP_001786248.1 predicted protein [Physcomitrella patens] EDQ48940.1 predicted protein [Physcomitrella patens] Length = 436 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R+ RG KEGLVLIYDT EW RGP LP+++NGA C VV+C Sbjct: 389 DLLRRSGRNGRGYKEGLVLIYDTCTLEWSRGPDLPYVKNGATCTVVQC 436 >XP_002970115.1 hypothetical protein SELMODRAFT_92558 [Selaginella moellendorffii] EFJ29239.1 hypothetical protein SELMODRAFT_92558 [Selaginella moellendorffii] Length = 384 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRR R+ RGL+EGLVL+YDT+ QEW + P+LP ++NGA CAVV+C Sbjct: 337 DLLRRGGRNPRGLREGLVLVYDTRGQEWSKAPHLPDMRNGAVCAVVQC 384 >XP_002985305.1 hypothetical protein SELMODRAFT_121884 [Selaginella moellendorffii] EFJ13799.1 hypothetical protein SELMODRAFT_121884 [Selaginella moellendorffii] Length = 384 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRR R+ RGL+EGLVL+YDT+ QEW + P+LP ++NGA CAVV+C Sbjct: 337 DLLRRGGRNPRGLREGLVLVYDTRGQEWSKAPHLPDMRNGAVCAVVQC 384 >AEW07744.1 hypothetical protein 0_10449_01, partial [Pinus radiata] AEW07745.1 hypothetical protein 0_10449_01, partial [Pinus lambertiana] AFG68954.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68955.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68956.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68957.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68958.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68959.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68960.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68961.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68962.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68963.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68964.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68965.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68966.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68967.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68968.1 hypothetical protein 0_10449_01, partial [Pinus taeda] AFG68969.1 hypothetical protein 0_10449_01, partial [Pinus taeda] Length = 35 Score = 62.8 bits (151), Expect = 4e-11 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 331 KEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 KEGLVLIYDTKL EW RGP LP ++NGA CA VEC Sbjct: 1 KEGLVLIYDTKLHEWARGPDLPLVKNGAVCAAVEC 35 >XP_008451069.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Cucumis melo] Length = 435 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS RGLKEGLVLIY+TK EW+RG +P + AAC VEC Sbjct: 388 DLLRRSGRSARGLKEGLVLIYETKSGEWRRGAEMPEVMQRAACVCVEC 435 >XP_004144149.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Cucumis sativus] KGN66396.1 hypothetical protein Csa_1G600860 [Cucumis sativus] Length = 439 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS RGLKEGLVLIY+TK EW+RG +P + AAC VEC Sbjct: 392 DLLRRSGRSARGLKEGLVLIYETKSGEWRRGAEMPEVMQRAACVCVEC 439 >OAY57924.1 hypothetical protein MANES_02G135500 [Manihot esculenta] Length = 421 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R++RGLKEGL+L+YD+ EW RGP LP + AAC VEC Sbjct: 374 DLLRRSGRNIRGLKEGLILVYDSGRGEWSRGPDLPGVIRRAACVTVEC 421 >XP_011036379.1 PREDICTED: F-box/kelch-repeat protein At5g26960-like [Populus euphratica] Length = 413 Score = 64.7 bits (156), Expect = 1e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS+RGLKEGLVLIYD EW RGP LP + AC VEC Sbjct: 366 DLLRRSGRSVRGLKEGLVLIYDCISGEWSRGPDLPEVIRRGACVTVEC 413 >XP_002313276.2 hypothetical protein POPTR_0009s07090g [Populus trichocarpa] EEE87231.2 hypothetical protein POPTR_0009s07090g [Populus trichocarpa] Length = 420 Score = 64.7 bits (156), Expect = 1e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS+RGLKEGLVLIYD EW RGP LP + AC VEC Sbjct: 373 DLLRRSGRSVRGLKEGLVLIYDCISGEWSRGPDLPEVIRRGACVTVEC 420 >XP_012076012.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Jatropha curcas] KDP34562.1 hypothetical protein JCGZ_11112 [Jatropha curcas] Length = 414 Score = 64.3 bits (155), Expect = 1e-09 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLR S R++RGLKEGLVLIYD +EW RGP LP + AAC VEC Sbjct: 367 DLLRGSGRNVRGLKEGLVLIYDCSREEWIRGPDLPEVMRRAACVSVEC 414 >XP_002523232.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Ricinus communis] EEF39153.1 conserved hypothetical protein [Ricinus communis] Length = 420 Score = 63.9 bits (154), Expect = 2e-09 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R++RGL+EGLVLIYD EW RGP LP + AAC VEC Sbjct: 373 DLLRRSGRNVRGLREGLVLIYDCADGEWSRGPDLPEVIRRAACVTVEC 420 >XP_010673803.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Beta vulgaris subsp. vulgaris] KMT14644.1 hypothetical protein BVRB_4g074120 [Beta vulgaris subsp. vulgaris] Length = 422 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R++RG KEGLVLI+D +EW RGP LP + AAC VEC Sbjct: 375 DLLRRSGRNVRGYKEGLVLIFDCGTEEWSRGPDLPEVVQRAACVCVEC 422 >XP_011025021.1 PREDICTED: F-box/kelch-repeat protein At5g26960-like [Populus euphratica] Length = 423 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R++RGLKEGLVL+YD W RGP+LP + AAC VEC Sbjct: 376 DLLRRSGRNIRGLKEGLVLVYDCISGVWSRGPHLPEVIRRAACVTVEC 423 >XP_002299964.1 hypothetical protein POPTR_0001s27880g [Populus trichocarpa] EEE84769.1 hypothetical protein POPTR_0001s27880g [Populus trichocarpa] Length = 421 Score = 62.8 bits (151), Expect = 5e-09 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS R++RGLKEGLVL+YD W RGP+LP + A C VEC Sbjct: 374 DLLRRSGRNVRGLKEGLVLVYDCVSGVWSRGPHLPEVIRRATCVTVEC 421 >XP_002268943.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Vitis vinifera] Length = 416 Score = 62.4 bits (150), Expect = 6e-09 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS RGL+EGLVLIYD EW RG LP + AAC VEC Sbjct: 369 DLLRRSGRSTRGLREGLVLIYDAAAGEWSRGADLPEVIRRAACVCVEC 416 >XP_017627448.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Gossypium arboreum] Length = 428 Score = 62.4 bits (150), Expect = 6e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS RG K+GLVL+YD+ EW RGP LP + AAC VEC Sbjct: 381 DLLRRSGRSQRGFKDGLVLVYDSGGGEWSRGPDLPEVIRRAACVSVEC 428 >XP_016743967.1 PREDICTED: F-box/kelch-repeat protein At5g26960-like [Gossypium hirsutum] XP_016743968.1 PREDICTED: F-box/kelch-repeat protein At5g26960-like [Gossypium hirsutum] Length = 428 Score = 62.4 bits (150), Expect = 6e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS RG K+GLVL+YD+ EW RGP LP + AAC VEC Sbjct: 381 DLLRRSGRSQRGFKDGLVLVYDSGGGEWSRGPDLPEVIRRAACVSVEC 428 >XP_012478079.1 PREDICTED: F-box/kelch-repeat protein At5g26960 [Gossypium raimondii] KJB09282.1 hypothetical protein B456_001G132900 [Gossypium raimondii] Length = 430 Score = 62.4 bits (150), Expect = 6e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -1 Query: 370 DLLRRSERSMRGLKEGLVLIYDTKLQEWQRGPYLPFIQNGAACAVVEC 227 DLLRRS RS RG K+GLVL+YD+ EW RGP LP + AAC VEC Sbjct: 383 DLLRRSGRSQRGFKDGLVLVYDSGGGEWSRGPDLPEVIRRAACVSVEC 430