BLASTX nr result
ID: Ephedra29_contig00016061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016061 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP10223.1 unnamed protein product [Coffea canephora] 55 3e-06 >CDP10223.1 unnamed protein product [Coffea canephora] Length = 441 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 71 FIDINLDYFGVVLDLLRKGE*EMPTGMS*RAFYRKSLYYGIVDRV 205 FID N DYF V+LDLLR GE +P+ MS + YR++L+YGI+D V Sbjct: 53 FIDRNPDYFAVLLDLLRTGELYLPSNMSEKQLYREALFYGILDHV 97