BLASTX nr result
ID: Ephedra29_contig00016034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016034 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010242516.1 PREDICTED: origin of replication complex subunit ... 54 3e-06 XP_010242515.1 PREDICTED: origin of replication complex subunit ... 54 3e-06 >XP_010242516.1 PREDICTED: origin of replication complex subunit 3 isoform X2 [Nelumbo nucifera] Length = 624 Score = 53.9 bits (128), Expect = 3e-06 Identities = 23/51 (45%), Positives = 36/51 (70%) Frame = +3 Query: 72 VTQILRKLRDLSRPLLFSLLQSWEKRTKGLPEIHQEVQRLQQIIGCDENGK 224 ++Q++R++RDL LL LL W K TKG+ EIH +V+ LQ ++ ++NGK Sbjct: 490 ISQVVRRVRDLPVALLSQLLNIWRKHTKGISEIHDKVKELQSMLKFEDNGK 540 >XP_010242515.1 PREDICTED: origin of replication complex subunit 3 isoform X1 [Nelumbo nucifera] Length = 741 Score = 53.9 bits (128), Expect = 3e-06 Identities = 23/51 (45%), Positives = 36/51 (70%) Frame = +3 Query: 72 VTQILRKLRDLSRPLLFSLLQSWEKRTKGLPEIHQEVQRLQQIIGCDENGK 224 ++Q++R++RDL LL LL W K TKG+ EIH +V+ LQ ++ ++NGK Sbjct: 490 ISQVVRRVRDLPVALLSQLLNIWRKHTKGISEIHDKVKELQSMLKFEDNGK 540