BLASTX nr result
ID: Ephedra29_contig00016000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00016000 (755 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAQ84192.1 protein with ubiquitin conjugating enzyme domain [Kle... 59 3e-06 >GAQ84192.1 protein with ubiquitin conjugating enzyme domain [Klebsormidium flaccidum] Length = 1078 Score = 58.5 bits (140), Expect = 3e-06 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 16 QFTVIY-DLEREEVFQKLRALNGSIFAFYGRSPCNWYSIIRNGLRCMSKTGSETY 177 QF V+ D E+E F LRA GS FAF+G S NWYSI+RNGLR MS T + Y Sbjct: 668 QFVVLTADPEKEAAFAALRASKGSFFAFHGSSGENWYSILRNGLRSMSGTSYQMY 722